YQIW - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQIW - UPF0403 protein YqiW

UniProt:	P54534	Sequences: MNMDFNLFMNDIVRQARQEITAAGYTELKTAEEVDEALTKKGTTLVMVNSVCGCAGGIARPAAYHSVHYDKRPDQLVTVFAGQDKEATARARDYFEGYPPSSPSFAILKDGKIMKMVERHEIEGHEPMAVVAKLQEAFEEYCEEV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (136)
Sequences:	482 (197)
Seq/√Len:	16.9

BACSU - YQIW YPHP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_S	138_F	5.064	1.00
35_D	90_R	4.113	1.00
14_R	18_Q	3.456	1.00
90_R	93_D	3.148	0.99
41_K	110_D	2.847	0.98
63_A	105_F	2.821	0.98
33_E	36_E	2.719	0.97
19_E	64_Y	2.301	0.93
69_Y	139_E	2.284	0.93
56_G	130_V	2.284	0.93
95_F	108_L	2.261	0.92
67_V	138_F	2.246	0.92
115_K	137_A	2.216	0.91
23_A	64_Y	2.124	0.90
45_L	134_L	2.063	0.88
40_K	75_Q	1.997	0.86
18_Q	22_A	1.828	0.81
133_K	137_A	1.778	0.79
17_R	27_E	1.730	0.77
21_T	27_E	1.692	0.75
89_A	93_D	1.683	0.75
48_V	95_F	1.651	0.74
16_A	20_I	1.548	0.69
22_A	64_Y	1.525	0.67
8_F	15_Q	1.521	0.67
26_T	33_E	1.515	0.67
107_I	138_F	1.500	0.66
29_K	84_D	1.442	0.63
88_T	94_Y	1.439	0.63
83_Q	88_T	1.420	0.62
115_K	133_K	1.418	0.62
69_Y	135_Q	1.410	0.61
25_Y	76_L	1.399	0.60
91_A	95_F	1.397	0.60
38_L	91_A	1.308	0.55
8_F	56_G	1.270	0.53
118_E	124_G	1.265	0.53
107_I	141_Y	1.262	0.52
125_H	133_K	1.225	0.50
13_V	77_V	1.216	0.50
106_A	116_M	1.209	0.49
62_A	126_E	1.187	0.48
125_H	129_A	1.169	0.47
52_C	102_S	1.168	0.47
42_G	110_D	1.162	0.46
114_M	141_Y	1.155	0.46
37_A	44_T	1.155	0.46
17_R	83_Q	1.151	0.46
35_D	39_T	1.149	0.46
35_D	94_Y	1.141	0.45
98_Y	118_E	1.141	0.45
127_P	131_V	1.138	0.45
91_A	116_M	1.136	0.45
44_T	77_V	1.126	0.44
67_V	76_L	1.118	0.44
20_I	47_M	1.117	0.44
99_P	118_E	1.103	0.43
108_L	113_I	1.099	0.43
37_A	116_M	1.092	0.42
79_V	88_T	1.081	0.42
9_M	58_I	1.071	0.41
47_M	105_F	1.066	0.41
65_H	68_H	1.061	0.41
50_S	54_C	1.043	0.40
35_D	85_K	1.042	0.39
44_T	75_Q	1.030	0.39
71_K	107_I	1.029	0.39
107_I	142_C	1.027	0.39
17_R	62_A	1.022	0.38
128_M	132_A	1.006	0.37
28_L	77_V	1.004	0.37
97_G	118_E	0.992	0.37
25_Y	63_A	0.988	0.36
96_E	112_K	0.975	0.36
45_L	137_A	0.971	0.36
98_Y	116_M	0.970	0.35
105_F	110_D	0.945	0.34
62_A	104_S	0.934	0.34
65_H	131_V	0.922	0.33
43_T	142_C	0.921	0.33
59_A	62_A	0.915	0.33
91_A	110_D	0.908	0.32
131_V	134_L	0.901	0.32
107_I	137_A	0.869	0.30
99_P	127_P	0.844	0.29
69_Y	72_R	0.839	0.29
94_Y	97_G	0.835	0.28
134_L	141_Y	0.832	0.28
23_A	63_A	0.828	0.28
90_R	97_G	0.827	0.28
104_S	128_M	0.825	0.28
19_E	83_Q	0.824	0.28
98_Y	113_I	0.819	0.28
47_M	56_G	0.805	0.27
81_A	92_R	0.804	0.27
26_T	40_K	0.803	0.27
83_Q	95_F	0.803	0.27
38_L	110_D	0.799	0.27
8_F	130_V	0.798	0.27
38_L	94_Y	0.795	0.27
8_F	133_K	0.794	0.27
7_L	10_N	0.792	0.26
16_A	56_G	0.791	0.26
13_V	29_K	0.789	0.26
29_K	33_E	0.784	0.26
46_V	91_A	0.777	0.26
108_L	140_E	0.768	0.25
47_M	130_V	0.757	0.25
45_L	86_E	0.756	0.25
54_C	119_R	0.741	0.24
50_S	119_R	0.741	0.24
58_I	130_V	0.735	0.24
65_H	127_P	0.727	0.24
66_S	135_Q	0.724	0.23
30_T	33_E	0.722	0.23
40_K	117_V	0.721	0.23
53_G	92_R	0.712	0.23
38_L	111_G	0.707	0.23
30_T	40_K	0.706	0.23
25_Y	59_A	0.697	0.22
91_A	111_G	0.697	0.22
67_V	90_R	0.697	0.22
56_G	115_K	0.697	0.22
82_G	102_S	0.696	0.22
52_C	82_G	0.695	0.22
19_E	57_G	0.694	0.22
112_K	141_Y	0.691	0.22
20_I	25_Y	0.683	0.22
124_G	140_E	0.682	0.22
132_A	136_E	0.682	0.22
71_K	74_D	0.681	0.22
53_G	80_F	0.677	0.21
31_A	76_L	0.674	0.21
73_P	142_C	0.668	0.21
109_K	140_E	0.667	0.21
115_K	130_V	0.663	0.21
62_A	67_V	0.662	0.21
7_L	118_E	0.661	0.21
54_C	102_S	0.661	0.21
50_S	102_S	0.661	0.21
125_H	131_V	0.660	0.21
62_A	127_P	0.658	0.21
37_A	40_K	0.651	0.20
17_R	29_K	0.649	0.20
9_M	104_S	0.647	0.20
31_A	124_G	0.639	0.20
99_P	113_I	0.636	0.20
26_T	75_Q	0.636	0.20
55_A	79_V	0.633	0.20
38_L	112_K	0.630	0.20
90_R	94_Y	0.628	0.20
107_I	133_K	0.627	0.20
41_K	72_R	0.621	0.19
113_I	116_M	0.620	0.19
118_E	121_E	0.615	0.19
126_E	129_A	0.612	0.19
77_V	124_G	0.612	0.19
46_V	74_D	0.611	0.19
33_E	93_D	0.605	0.19
121_E	125_H	0.605	0.19
44_T	112_K	0.601	0.19
67_V	135_Q	0.599	0.19
91_A	118_E	0.599	0.19
114_M	133_K	0.589	0.18
81_A	102_S	0.585	0.18
52_C	81_A	0.585	0.18
33_E	38_L	0.582	0.18
108_L	114_M	0.582	0.18
37_A	91_A	0.581	0.18
80_F	92_R	0.575	0.18
15_Q	20_I	0.574	0.18
41_K	74_D	0.569	0.17
68_H	72_R	0.568	0.17
32_E	112_K	0.566	0.17
37_A	77_V	0.561	0.17
56_G	137_A	0.557	0.17
25_Y	58_I	0.554	0.17
18_Q	86_E	0.552	0.17
26_T	136_E	0.547	0.17
37_A	75_Q	0.546	0.17
40_K	44_T	0.542	0.17
42_G	74_D	0.540	0.16
12_I	125_H	0.540	0.16
37_A	111_G	0.536	0.16
14_R	135_Q	0.535	0.16
65_H	70_D	0.535	0.16
28_L	59_A	0.534	0.16
63_A	67_V	0.532	0.16
39_T	111_G	0.531	0.16
47_M	128_M	0.523	0.16
50_S	53_G	0.523	0.16
43_T	107_I	0.521	0.16
48_V	96_E	0.521	0.16
58_I	62_A	0.519	0.16
15_Q	51_V	0.518	0.16
88_T	110_D	0.516	0.16
57_G	83_Q	0.514	0.16
108_L	121_E	0.513	0.16
54_C	80_F	0.511	0.16
50_S	80_F	0.511	0.16
8_F	41_K	0.509	0.15
14_R	21_T	0.504	0.15
21_T	114_M	0.503	0.15
35_D	70_D	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3fhkA	4	0.9793	100	0.026	Contact Map
4euyA	1	0.5724	92.9	0.926	Contact Map
2j23A	1	0.7517	92.1	0.928	Contact Map
2qgvA	2	0.8069	90.4	0.931	Contact Map
1ep7A	1	0.731	89.6	0.932	Contact Map
4i8bA	2	0.6966	89.4	0.933	Contact Map
3iv4A	1	0.731	89.4	0.933	Contact Map
1xwbA	2	0.7034	86.8	0.936	Contact Map
4oo4A	2	0.6966	85.5	0.937	Contact Map
2vm1A	1	0.731	85.2	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.