EX7S - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

EX7S - Exodeoxyribonuclease 7 small subunit

UniProt:	P54522	Sequences: MTDVKKNENMTFEEAMKGLESIVSKLEEGDVPLEQAINYFQEGMALSKMCHEKLQKVEKQMDFILKEDGELAPFSVQEEDEGDK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	84 (72)
Sequences:	856 (569)
Seq/√Len:	67.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_G	42_E	6.627	1.00
32_P	36_A	3.894	1.00
37_I	44_M	2.854	1.00
41_Q	45_A	2.336	1.00
34_E	53_K	2.205	1.00
52_E	56_K	2.204	1.00
41_Q	60_Q	2.202	1.00
25_K	39_Y	2.117	1.00
14_E	17_K	2.080	1.00
15_A	49_M	1.910	1.00
25_K	35_Q	1.905	1.00
15_A	50_C	1.866	1.00
37_I	57_V	1.820	1.00
38_N	41_Q	1.622	0.99
31_V	39_Y	1.559	0.99
17_K	21_S	1.382	0.98
21_S	25_K	1.332	0.97
40_F	65_L	1.290	0.97
51_H	55_Q	1.272	0.96
22_I	39_Y	1.248	0.96
9_N	72_A	1.215	0.95
48_K	52_E	1.200	0.95
11_T	14_E	1.142	0.93
61_M	64_I	1.124	0.93
44_M	51_H	1.102	0.92
41_Q	61_M	1.093	0.92
41_Q	59_K	1.081	0.91
18_G	21_S	1.078	0.91
32_P	35_Q	1.077	0.91
21_S	72_A	1.056	0.90
66_K	71_L	1.033	0.89
63_F	74_F	1.029	0.89
31_V	64_I	1.023	0.89
10_M	18_G	1.021	0.89
12_F	16_M	1.007	0.88
44_M	47_S	1.005	0.88
39_Y	50_C	0.976	0.86
41_Q	64_I	0.967	0.86
65_L	72_A	0.956	0.85
23_V	60_Q	0.876	0.80
16_M	57_V	0.872	0.79
10_M	15_A	0.863	0.79
22_I	66_K	0.853	0.78
34_E	47_S	0.822	0.75
16_M	58_E	0.804	0.74
48_K	67_E	0.792	0.73
61_M	76_V	0.791	0.72
62_D	73_P	0.785	0.72
36_A	57_V	0.782	0.72
51_H	61_M	0.778	0.71
22_I	47_S	0.772	0.71
35_Q	38_N	0.764	0.70
10_M	52_E	0.716	0.65
69_G	72_A	0.709	0.64
60_Q	64_I	0.707	0.64
65_L	74_F	0.707	0.64
40_F	63_F	0.701	0.63
37_I	47_S	0.700	0.63
63_F	71_L	0.688	0.62
45_A	49_M	0.683	0.61
20_E	50_C	0.679	0.61
37_I	64_I	0.672	0.60
40_F	76_V	0.670	0.60
60_Q	63_F	0.668	0.59
41_Q	57_V	0.668	0.59
17_K	44_M	0.664	0.59
26_L	62_D	0.663	0.59
55_Q	59_K	0.653	0.58
22_I	28_E	0.647	0.57
22_I	63_F	0.640	0.56
11_T	16_M	0.640	0.56
37_I	41_Q	0.636	0.56
17_K	77_Q	0.632	0.55
23_V	32_P	0.630	0.55
66_K	69_G	0.614	0.53
24_S	55_Q	0.611	0.53
55_Q	73_P	0.604	0.52
39_Y	61_M	0.602	0.52
43_G	73_P	0.599	0.51
11_T	53_K	0.596	0.51
23_V	40_F	0.595	0.51
37_I	48_K	0.585	0.50
34_E	45_A	0.584	0.50
48_K	59_K	0.578	0.49
14_E	18_G	0.578	0.49
28_E	35_Q	0.577	0.49
58_E	65_L	0.573	0.48
51_H	57_V	0.570	0.48
15_A	51_H	0.558	0.46
21_S	24_S	0.558	0.46
41_Q	47_S	0.555	0.46
37_I	53_K	0.540	0.44
20_E	77_Q	0.539	0.44
61_M	74_F	0.534	0.44
43_G	65_L	0.529	0.43
63_F	76_V	0.526	0.43
35_Q	48_K	0.525	0.43
26_L	78_E	0.524	0.42
30_D	45_A	0.521	0.42
36_A	53_K	0.521	0.42
40_F	47_S	0.521	0.42
38_N	75_S	0.516	0.42
16_M	55_Q	0.512	0.41
34_E	77_Q	0.508	0.41
47_S	58_E	0.505	0.40
66_K	70_E	0.504	0.40
10_M	49_M	0.501	0.40
53_K	60_Q	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vp7A	2	0.9286	99.8	0.318	Contact Map
4tptA	2	0.5952	23.8	0.895	Contact Map
4cqeA	1	0.2976	15.1	0.904	Contact Map
2ozoA	1	0.4643	14.6	0.905	Contact Map
2psqA	2	0.3333	14.1	0.905	Contact Map
2w1iA	1	0.3333	13.9	0.905	Contact Map
3lxpA	1	0.3333	13.2	0.906	Contact Map
3ugcA	1	0.2976	11.7	0.909	Contact Map
4qqtA	1	0.3095	10.4	0.911	Contact Map
3socA	1	0.3095	10.3	0.911	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.