NUSB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NUSB - N utilization substance protein B homolog

UniProt:	P54520	Sequences: MKRRTAREKALQALFQIDVSDIAVNEAIEHALDEEKTDPFFEQLVHGVLEHQDQLDEMISKHLVNWKLDRIANVDRAILRLAAYEMAYAEDIPVNVSMNEAIELAKRFGDDKATKFVNGVLSNIKSDIEQS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	131 (125)
Sequences:	3375 (2406)
Seq/√Len:	215.2

ECOLI - NUSB
BACSU - NUSB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_G	84_Y	3.568	1.00
56_D	80_R	3.511	1.00
51_H	54_Q	2.890	1.00
92_I	97_S	2.509	1.00
93_P	96_V	2.472	1.00
83_A	124_I	2.412	1.00
63_L	71_I	2.378	1.00
62_H	127_D	2.360	1.00
43_Q	89_A	2.286	1.00
82_A	101_A	2.101	1.00
10_A	44_L	2.085	1.00
8_E	107_R	2.035	1.00
57_E	61_K	2.009	1.00
51_H	88_Y	1.874	1.00
42_E	46_H	1.773	1.00
75_D	109_G	1.754	1.00
73_N	76_R	1.725	1.00
58_M	87_A	1.699	1.00
15_F	19_V	1.692	1.00
72_A	75_D	1.673	1.00
18_D	76_R	1.671	1.00
61_K	127_D	1.670	1.00
12_Q	108_F	1.658	1.00
55_L	83_A	1.616	1.00
75_D	113_A	1.594	1.00
78_I	105_A	1.580	1.00
10_A	45_V	1.504	1.00
58_M	124_I	1.499	1.00
99_N	106_K	1.488	1.00
60_S	68_L	1.450	1.00
44_L	84_Y	1.446	1.00
94_V	125_K	1.430	1.00
57_E	60_S	1.411	1.00
40_F	44_L	1.405	1.00
86_M	97_S	1.397	1.00
66_W	70_R	1.392	1.00
99_N	103_E	1.386	1.00
46_H	50_E	1.346	1.00
105_A	117_V	1.332	1.00
11_L	81_L	1.329	1.00
40_F	92_I	1.323	1.00
84_Y	89_A	1.311	1.00
78_I	101_A	1.302	1.00
59_I	83_A	1.299	1.00
11_L	77_A	1.272	1.00
54_Q	57_E	1.225	1.00
55_L	88_Y	1.215	1.00
98_M	125_K	1.197	1.00
10_A	48_V	1.194	1.00
14_L	81_L	1.152	1.00
102_I	114_T	1.127	1.00
63_L	67_K	1.108	1.00
52_Q	80_R	1.108	1.00
81_L	104_L	1.108	1.00
103_E	106_K	1.104	1.00
78_I	117_V	1.096	1.00
48_V	84_Y	1.090	1.00
86_M	125_K	1.083	1.00
26_E	29_E	1.058	1.00
122_S	126_S	1.049	1.00
62_H	124_I	1.047	1.00
8_E	12_Q	1.028	1.00
123_N	126_S	0.987	1.00
17_I	49_L	0.985	1.00
79_L	117_V	0.976	1.00
52_Q	56_D	0.974	1.00
25_N	46_H	0.969	1.00
54_Q	88_Y	0.964	1.00
105_A	114_T	0.937	0.99
109_G	113_A	0.931	0.99
98_M	122_S	0.920	0.99
13_A	41_F	0.918	0.99
64_V	123_N	0.918	0.99
75_D	110_D	0.901	0.99
15_F	73_N	0.896	0.99
62_H	123_N	0.896	0.99
44_L	48_V	0.885	0.99
8_E	108_F	0.872	0.99
11_L	15_F	0.872	0.99
44_L	81_L	0.860	0.99
68_L	76_R	0.858	0.99
119_G	122_S	0.839	0.99
63_L	120_V	0.838	0.99
60_S	69_D	0.838	0.99
110_D	114_T	0.833	0.99
43_Q	84_Y	0.825	0.99
51_H	87_A	0.813	0.99
54_Q	87_A	0.812	0.99
98_M	102_I	0.809	0.99
14_L	77_A	0.807	0.98
65_N	122_S	0.803	0.98
102_I	117_V	0.801	0.98
8_E	104_L	0.800	0.98
27_A	31_A	0.798	0.98
110_D	113_A	0.796	0.98
89_A	92_I	0.796	0.98
6_A	10_A	0.793	0.98
76_R	80_R	0.791	0.98
29_E	33_D	0.787	0.98
27_A	30_H	0.786	0.98
21_D	49_L	0.777	0.98
23_A	26_E	0.777	0.98
39_P	43_Q	0.774	0.98
18_D	80_R	0.766	0.98
71_I	75_D	0.766	0.98
48_V	52_Q	0.765	0.98
15_F	74_V	0.761	0.98
11_L	74_V	0.761	0.98
96_V	100_E	0.758	0.98
58_M	61_K	0.758	0.98
95_N	122_S	0.751	0.98
54_Q	58_M	0.739	0.97
59_I	63_L	0.739	0.97
53_D	57_E	0.735	0.97
13_A	45_V	0.735	0.97
102_I	118_N	0.733	0.97
102_I	106_K	0.725	0.97
38_D	42_E	0.721	0.97
82_A	85_E	0.702	0.96
62_H	120_V	0.684	0.96
28_I	42_E	0.679	0.96
5_T	9_K	0.675	0.95
60_S	67_K	0.674	0.95
4_R	103_E	0.672	0.95
37_T	41_F	0.671	0.95
58_M	83_A	0.664	0.95
38_D	41_F	0.664	0.95
65_N	116_F	0.663	0.95
4_R	107_R	0.661	0.95
48_V	55_L	0.660	0.95
11_L	78_I	0.660	0.95
90_E	97_S	0.651	0.95
30_H	33_D	0.649	0.94
11_L	108_F	0.649	0.94
92_I	96_V	0.647	0.94
44_L	89_A	0.646	0.94
102_I	105_A	0.644	0.94
6_A	40_F	0.642	0.94
26_E	30_H	0.639	0.94
16_Q	20_S	0.638	0.94
49_L	52_Q	0.634	0.94
9_K	12_Q	0.634	0.94
56_D	76_R	0.634	0.94
55_L	59_I	0.627	0.93
68_L	71_I	0.625	0.93
6_A	41_F	0.625	0.93
43_Q	50_E	0.622	0.93
40_F	81_L	0.613	0.93
18_D	114_T	0.609	0.92
17_I	27_A	0.603	0.92
41_F	44_L	0.599	0.92
89_A	97_S	0.596	0.91
16_Q	19_V	0.594	0.91
19_V	73_N	0.591	0.91
32_L	42_E	0.590	0.91
55_L	84_Y	0.588	0.91
73_N	77_A	0.584	0.91
82_A	97_S	0.584	0.91
123_N	127_D	0.581	0.90
109_G	114_T	0.581	0.90
12_Q	41_F	0.575	0.90
72_A	122_S	0.572	0.90
63_L	68_L	0.571	0.90
70_R	110_D	0.570	0.90
35_E	38_D	0.562	0.89
58_M	62_H	0.557	0.89
18_D	77_A	0.556	0.88
47_G	50_E	0.555	0.88
4_R	104_L	0.554	0.88
14_L	48_V	0.553	0.88
72_A	113_A	0.550	0.88
24_V	49_L	0.548	0.88
58_M	79_L	0.548	0.88
67_K	71_I	0.541	0.87
17_I	52_Q	0.538	0.87
48_V	81_L	0.526	0.86
86_M	94_V	0.523	0.85
67_K	70_R	0.523	0.85
13_A	31_A	0.522	0.85
70_R	109_G	0.522	0.85
14_L	18_D	0.515	0.84
59_I	71_I	0.514	0.84
51_H	55_L	0.511	0.84
24_V	27_A	0.509	0.84
103_E	107_R	0.504	0.83
10_A	41_F	0.504	0.83
95_N	102_I	0.500	0.83
52_Q	55_L	0.500	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1q8cA	1	0.9008	100	0.185	Contact Map
3r2dA	1	1	100	0.204	Contact Map
1tzvA	1	1	100	0.211	Contact Map
1eyvA	2	0.9542	100	0.225	Contact Map
3d3bA	1	0.9924	100	0.228	Contact Map
1sqgA	1	0.9618	100	0.364	Contact Map
2yxlA	1	0.9618	99.9	0.392	Contact Map
3ilwA	2	0.8397	16	0.932	Contact Map
2zc2A	1	0.5267	14.6	0.933	Contact Map
4am5A	6	0.9618	13.3	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.