YQHY - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQHY - Uncharacterized protein YqhY

UniProt:	P54519	Sequences: MKDNSLLKMDHEDTHLGKVEIAPEVIEVIAGIAASEVDGVAEMRGNFATGVVERFGKVNHGKGVKVDLADDGITIDVYCVVTFGVSIPKVAASVQENIRQTLLNMTSLSINEINIHIVGIQFDTKAQEVQIDEEM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	135 (113)
Sequences:	2065 (1181)
Seq/√Len:	111.1

BACSU - YQHY YLOU

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
76_D	114_N	5.157	1.00
72_G	109_S	3.377	1.00
79_C	94_V	2.661	1.00
29_I	105_M	2.514	1.00
75_I	102_L	2.442	1.00
81_V	87_I	2.387	1.00
72_G	111_N	2.276	1.00
78_Y	116_H	2.155	1.00
36_E	97_N	2.152	1.00
110_I	113_I	2.109	1.00
78_Y	118_V	2.087	1.00
31_G	60_H	2.068	1.00
74_T	112_E	2.015	1.00
40_V	94_V	1.984	1.00
69_A	72_G	1.938	1.00
34_A	43_M	1.858	1.00
30_A	75_I	1.803	1.00
87_I	117_I	1.802	1.00
99_R	103_L	1.713	1.00
69_A	74_T	1.650	1.00
41_A	121_Q	1.648	1.00
77_V	98_I	1.640	1.00
86_S	89_K	1.547	1.00
71_D	111_N	1.543	1.00
69_A	111_N	1.534	1.00
27_E	66_V	1.514	1.00
38_D	85_V	1.491	1.00
64_V	77_V	1.444	1.00
89_K	93_S	1.426	1.00
81_V	90_V	1.420	1.00
41_A	122_F	1.414	1.00
43_M	63_G	1.410	1.00
74_T	111_N	1.343	1.00
93_S	96_E	1.338	1.00
12_E	15_H	1.329	1.00
38_D	82_T	1.329	1.00
33_A	101_T	1.328	1.00
85_V	90_V	1.322	1.00
82_T	123_D	1.291	0.99
44_R	80_V	1.283	0.99
42_E	80_V	1.283	0.99
80_V	119_G	1.275	0.99
89_K	92_A	1.265	0.99
67_D	74_T	1.233	0.99
40_V	79_C	1.230	0.99
17_G	120_I	1.193	0.99
37_V	95_Q	1.186	0.99
79_C	117_I	1.181	0.99
103_L	109_S	1.143	0.99
30_A	102_L	1.138	0.99
30_A	66_V	1.116	0.98
53_E	62_K	1.109	0.98
34_A	94_V	1.104	0.98
66_V	75_I	1.083	0.98
94_V	115_I	1.060	0.98
101_T	105_M	1.044	0.97
103_L	110_I	1.021	0.97
81_V	85_V	1.020	0.97
14_T	93_S	1.016	0.97
27_E	61_G	0.997	0.97
95_Q	99_R	0.983	0.96
42_E	54_R	0.977	0.96
40_V	65_K	0.968	0.96
26_I	69_A	0.957	0.96
14_T	124_T	0.955	0.96
38_D	93_S	0.945	0.95
91_A	117_I	0.944	0.95
26_I	108_L	0.936	0.95
25_V	29_I	0.917	0.95
22_A	65_K	0.903	0.94
30_A	110_I	0.894	0.94
17_G	115_I	0.893	0.94
76_D	116_H	0.891	0.94
36_E	101_T	0.871	0.93
55_F	96_E	0.868	0.93
21_I	90_V	0.861	0.93
19_V	103_L	0.859	0.92
23_P	27_E	0.843	0.92
35_S	40_V	0.809	0.90
35_S	120_I	0.786	0.89
74_T	114_N	0.771	0.88
23_P	68_L	0.769	0.88
84_G	87_I	0.767	0.87
34_A	77_V	0.765	0.87
13_D	18_K	0.752	0.86
25_V	104_N	0.739	0.85
82_T	85_V	0.739	0.85
26_I	66_V	0.736	0.85
25_V	105_M	0.736	0.85
69_A	112_E	0.735	0.85
86_S	91_A	0.732	0.85
98_I	102_L	0.699	0.82
26_I	73_I	0.699	0.82
29_I	106_T	0.698	0.82
30_A	34_A	0.687	0.81
14_T	103_L	0.685	0.81
91_A	116_H	0.680	0.80
97_N	101_T	0.679	0.80
22_A	25_V	0.673	0.80
39_G	85_V	0.670	0.79
80_V	121_Q	0.664	0.79
37_V	97_N	0.657	0.78
24_E	65_K	0.653	0.78
52_V	107_S	0.652	0.77
21_I	87_I	0.652	0.77
42_E	98_I	0.648	0.77
79_C	115_I	0.645	0.77
102_L	110_I	0.644	0.77
100_Q	104_N	0.643	0.77
53_E	94_V	0.630	0.75
53_E	120_I	0.626	0.75
52_V	62_K	0.625	0.74
69_A	117_I	0.624	0.74
92_A	96_E	0.624	0.74
41_A	54_R	0.624	0.74
43_M	64_V	0.623	0.74
40_V	77_V	0.619	0.74
40_V	91_A	0.619	0.74
47_F	56_G	0.618	0.74
31_G	45_G	0.614	0.73
52_V	102_L	0.613	0.73
102_L	106_T	0.610	0.73
45_G	53_E	0.609	0.73
73_I	97_N	0.609	0.73
24_E	120_I	0.608	0.72
107_S	120_I	0.604	0.72
35_S	42_E	0.601	0.72
16_L	19_V	0.593	0.71
24_E	59_N	0.591	0.70
88_P	92_A	0.591	0.70
21_I	30_A	0.590	0.70
20_E	23_P	0.584	0.69
44_R	50_G	0.583	0.69
68_L	108_L	0.577	0.69
36_E	104_N	0.575	0.68
77_V	115_I	0.575	0.68
31_G	59_N	0.572	0.68
51_V	60_H	0.568	0.67
50_G	55_F	0.557	0.66
31_G	35_S	0.551	0.65
44_R	119_G	0.549	0.65
61_G	123_D	0.547	0.64
25_V	94_V	0.546	0.64
71_D	74_T	0.544	0.64
111_N	124_T	0.543	0.64
31_G	43_M	0.543	0.64
29_I	38_D	0.541	0.64
31_G	102_L	0.539	0.63
59_N	87_I	0.534	0.63
51_V	84_G	0.525	0.61
60_H	102_L	0.523	0.61
92_A	95_Q	0.522	0.61
29_I	108_L	0.521	0.61
40_V	64_V	0.520	0.61
86_S	90_V	0.518	0.60
94_V	113_I	0.517	0.60
32_I	60_H	0.516	0.60
38_D	100_Q	0.513	0.60
38_D	88_P	0.512	0.59
21_I	107_S	0.510	0.59
37_V	121_Q	0.510	0.59
67_D	73_I	0.508	0.59
79_C	110_I	0.506	0.59
43_M	118_V	0.506	0.59
68_L	73_I	0.505	0.58
70_D	111_N	0.503	0.58
91_A	115_I	0.502	0.58
66_V	73_I	0.502	0.58
89_K	100_Q	0.502	0.58
17_G	87_I	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4d2uA	3	0.5778	18.4	0.924	Contact Map
1wh9A	1	0.6593	12.8	0.929	Contact Map
4alzA	1	0.8	11.7	0.93	Contact Map
1qvrA	3	0.5852	5.9	0.939	Contact Map
4hvzA	5	0.5926	5.8	0.94	Contact Map
4hw9A	3	0.763	5.4	0.94	Contact Map
3zeyX	1	0.7407	4.2	0.943	Contact Map
3w61A	2	0.5704	4.1	0.944	Contact Map
4w23D	1	0.763	4	0.944	Contact Map
2f2hA	4	0.5111	3.8	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.