YQHR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQHR - Uncharacterized protein YqhR

UniProt:	P54516	Sequences: MMTSEKDTEQNEELNEKQKPPVSMAGRVAATGFCGGVLWSFVAYIAYLFHFSEISPNMILQPFVLGEWKKHGLGTVISIILIGVISIGAAFLYFLLLKRLKTMWPGILYGLVLWLLVFFVFNPIFPDVRTVTELTSDTIITTICIYLLYGLFVGYSISFEYNELNSEKLARALGMHRE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	178 (157)
Sequences:	176 (141)
Seq/√Len:	11.2

BACSU - YQHR

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
58_M	146_Y	3.353	0.97
13_E	16_E	3.280	0.97
114_W	142_T	2.828	0.93
140_I	146_Y	2.752	0.92
58_M	128_V	2.319	0.83
102_T	105_P	2.230	0.80
43_A	145_I	2.200	0.79
58_M	114_W	2.195	0.79
58_M	127_D	2.150	0.77
31_T	78_S	2.124	0.76
94_F	98_K	2.085	0.75
115_L	131_V	2.074	0.75
92_L	96_L	2.057	0.74
82_I	103_M	2.041	0.73
62_P	69_K	2.014	0.72
99_R	153_V	1.969	0.71
53_E	139_I	1.773	0.62
42_V	97_L	1.744	0.61
79_I	155_Y	1.742	0.61
117_V	146_Y	1.731	0.60
38_L	83_G	1.714	0.59
80_I	137_D	1.648	0.56
33_F	95_L	1.629	0.55
102_T	107_I	1.618	0.55
95_L	147_L	1.605	0.54
89_A	153_V	1.599	0.54
86_S	149_Y	1.594	0.54
104_W	108_L	1.587	0.53
95_L	146_Y	1.574	0.53
148_L	163_E	1.521	0.50
27_R	114_W	1.518	0.50
52_S	142_T	1.513	0.50
44_Y	87_I	1.497	0.49
35_G	119_F	1.495	0.49
47_Y	148_L	1.495	0.49
37_V	83_G	1.466	0.48
49_F	99_R	1.448	0.47
37_V	115_L	1.415	0.45
32_G	90_A	1.411	0.45
147_L	151_L	1.393	0.44
13_E	19_K	1.377	0.43
89_A	149_Y	1.360	0.42
122_N	160_E	1.358	0.42
45_I	107_I	1.358	0.42
117_V	121_F	1.337	0.41
72_G	78_S	1.291	0.39
25_A	91_F	1.291	0.39
51_F	104_W	1.283	0.39
62_P	66_G	1.268	0.38
111_L	143_I	1.244	0.37
52_S	96_L	1.238	0.37
106_G	109_Y	1.235	0.37
34_C	37_V	1.227	0.36
95_L	111_L	1.215	0.36
46_A	141_T	1.208	0.35
47_Y	53_E	1.208	0.35
141_T	155_Y	1.206	0.35
42_V	165_N	1.201	0.35
149_Y	153_V	1.192	0.35
130_T	133_E	1.185	0.34
14_L	119_F	1.177	0.34
71_H	76_V	1.170	0.34
13_E	21_P	1.160	0.33
42_V	145_I	1.155	0.33
112_V	132_T	1.153	0.33
41_F	79_I	1.145	0.33
100_L	105_P	1.137	0.32
15_N	42_V	1.133	0.32
38_L	71_H	1.110	0.31
38_L	143_I	1.104	0.31
66_G	69_K	1.091	0.30
128_V	140_I	1.084	0.30
53_E	135_T	1.073	0.30
107_I	112_V	1.067	0.29
36_G	144_C	1.067	0.29
87_I	131_V	1.062	0.29
23_S	126_P	1.059	0.29
29_A	92_L	1.056	0.29
57_N	78_S	1.055	0.29
156_S	159_F	1.049	0.29
26_G	141_T	1.037	0.28
119_F	131_V	1.035	0.28
52_S	61_Q	1.033	0.28
49_F	139_I	1.016	0.27
78_S	94_F	1.015	0.27
28_V	91_F	1.009	0.27
33_F	96_L	1.009	0.27
33_F	58_M	1.008	0.27
87_I	109_Y	1.002	0.27
115_L	119_F	0.989	0.26
54_I	134_L	0.987	0.26
43_A	117_V	0.982	0.26
48_L	135_T	0.977	0.26
73_L	125_F	0.959	0.25
50_H	58_M	0.937	0.24
16_E	19_K	0.933	0.24
39_W	52_S	0.912	0.24
55_S	94_F	0.908	0.23
84_V	88_G	0.901	0.23
135_T	159_F	0.896	0.23
61_Q	99_R	0.892	0.23
27_R	61_Q	0.889	0.23
99_R	140_I	0.886	0.23
77_I	92_L	0.885	0.23
123_P	144_C	0.883	0.23
83_G	98_K	0.872	0.22
75_T	82_I	0.870	0.22
77_I	87_I	0.869	0.22
41_F	84_V	0.869	0.22
91_F	133_E	0.866	0.22
62_P	78_S	0.864	0.22
135_T	158_S	0.855	0.22
17_K	91_F	0.853	0.22
92_L	115_L	0.851	0.22
81_L	141_T	0.846	0.21
125_F	156_S	0.844	0.21
66_G	140_I	0.844	0.21
50_H	141_T	0.834	0.21
16_E	156_S	0.833	0.21
56_P	74_G	0.825	0.21
54_I	161_Y	0.825	0.21
31_T	156_S	0.818	0.20
113_L	149_Y	0.810	0.20
42_V	92_L	0.809	0.20
32_G	36_G	0.809	0.20
44_Y	66_G	0.808	0.20
83_G	158_S	0.807	0.20
64_V	69_K	0.801	0.20
42_V	91_F	0.799	0.20
81_L	109_Y	0.798	0.20
17_K	131_V	0.797	0.20
32_G	144_C	0.795	0.20
124_I	158_S	0.793	0.20
98_K	159_F	0.791	0.20
106_G	160_E	0.791	0.20
65_L	69_K	0.789	0.20
29_A	116_L	0.785	0.19
45_I	153_V	0.781	0.19
89_A	109_Y	0.780	0.19
41_F	51_F	0.776	0.19
118_F	148_L	0.769	0.19
45_I	59_I	0.769	0.19
140_I	161_Y	0.768	0.19
42_V	71_H	0.764	0.19
125_F	161_Y	0.764	0.19
88_G	117_V	0.763	0.19
67_E	131_V	0.761	0.19
60_L	139_I	0.755	0.19
28_V	112_V	0.754	0.19
77_I	88_G	0.751	0.18
29_A	146_Y	0.743	0.18
27_R	160_E	0.742	0.18
91_F	132_T	0.735	0.18
14_L	97_L	0.733	0.18
34_C	164_L	0.728	0.18
122_N	131_V	0.725	0.18
57_N	160_E	0.716	0.17
30_A	46_A	0.713	0.17
103_M	151_L	0.709	0.17
115_L	120_V	0.708	0.17
68_W	83_G	0.707	0.17
120_V	135_T	0.705	0.17
50_H	96_L	0.704	0.17
17_K	153_V	0.704	0.17
88_G	109_Y	0.703	0.17
89_A	116_L	0.700	0.17
54_I	153_V	0.696	0.17
75_T	109_Y	0.693	0.17
41_F	99_R	0.691	0.17
75_T	114_W	0.686	0.17
127_D	142_T	0.686	0.17
75_T	127_D	0.684	0.17
36_G	86_S	0.683	0.17
26_G	146_Y	0.680	0.16
61_Q	142_T	0.674	0.16
29_A	91_F	0.672	0.16
95_L	156_S	0.670	0.16
123_P	157_I	0.670	0.16
103_M	167_E	0.661	0.16
25_A	77_I	0.652	0.16
68_W	149_Y	0.652	0.16
128_V	137_D	0.650	0.16
48_L	112_V	0.650	0.16
145_I	161_Y	0.646	0.16
26_G	46_A	0.642	0.15
98_K	156_S	0.641	0.15
142_T	149_Y	0.639	0.15
57_N	85_I	0.633	0.15
108_L	116_L	0.632	0.15
59_I	97_L	0.628	0.15
84_V	87_I	0.620	0.15
32_G	86_S	0.613	0.15
62_P	109_Y	0.611	0.15
89_A	146_Y	0.607	0.15
20_P	49_F	0.599	0.14
29_A	141_T	0.598	0.14
44_Y	122_N	0.592	0.14
45_I	137_D	0.586	0.14
36_G	123_P	0.582	0.14
38_L	100_L	0.580	0.14
76_V	111_L	0.579	0.14
90_A	121_F	0.578	0.14
72_G	131_V	0.577	0.14
128_V	168_K	0.577	0.14
49_F	66_G	0.577	0.14
45_I	129_R	0.576	0.14
50_H	127_D	0.574	0.14
141_T	157_I	0.573	0.14
107_I	168_K	0.567	0.14
79_I	118_F	0.562	0.14
33_F	161_Y	0.560	0.13
46_A	145_I	0.559	0.13
27_R	31_T	0.554	0.13
104_W	112_V	0.553	0.13
97_L	109_Y	0.545	0.13
114_W	131_V	0.543	0.13
54_I	101_K	0.540	0.13
26_G	37_V	0.540	0.13
65_L	82_I	0.539	0.13
32_G	123_P	0.537	0.13
43_A	48_L	0.529	0.13
28_V	90_A	0.527	0.13
137_D	148_L	0.526	0.13
100_L	109_Y	0.526	0.13
103_M	165_N	0.526	0.13
50_H	90_A	0.525	0.13
17_K	89_A	0.524	0.13
62_P	89_A	0.522	0.13
55_S	114_W	0.517	0.13
127_D	166_S	0.512	0.12
15_N	148_L	0.511	0.12
106_G	150_G	0.509	0.12
107_I	129_R	0.508	0.12
62_P	106_G	0.506	0.12
36_G	155_Y	0.504	0.12
38_L	69_K	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2onkC	2	0.8315	51.2	0.948	Contact Map
2cfqA	1	0.8652	45.7	0.95	Contact Map
4ikvA	1	0.8652	41.9	0.951	Contact Map
4od4A	1	0.7809	40.2	0.951	Contact Map
1pw4A	1	0.8258	28.4	0.955	Contact Map
3mk7C	2	0.5112	25.4	0.956	Contact Map
3wdoA	1	0.8596	24.6	0.956	Contact Map
3tx3A	2	0.7809	22	0.957	Contact Map
3o7qA	1	0.7472	19	0.959	Contact Map
4rp9A	2	0.9663	18.7	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.