YQHP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQHP - Uncharacterized protein YqhP

UniProt:	P54514	Sequences: MNHRVQPIIAVLIALGAFGFLYVLVTNPGEMAKMAVTVIVAGIIIYFIVKYVMNRNAGSEGAAFKKAAKQSRRRMKEQKAKHRAGHKGRVSHLRSVPSASKPKPMILKKKSQTQLTVIEGKKNKKKNRALF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	131 (119)
Sequences:	119 (104)
Seq/√Len:	9.6

BACSU - YQHP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_F	70_Q	3.314	0.95
64_F	68_A	3.279	0.95
31_M	35_A	2.704	0.87
28_P	121_K	2.659	0.86
78_Q	109_K	2.550	0.83
67_A	71_S	2.384	0.79
68_A	74_R	2.296	0.76
12_L	20_F	2.236	0.74
23_V	27_N	2.018	0.66
71_S	115_L	2.011	0.66
126_K	129_A	1.971	0.64
104_P	109_K	1.857	0.59
37_T	41_A	1.823	0.58
31_M	34_M	1.821	0.58
12_L	32_A	1.802	0.57
28_P	116_T	1.776	0.56
47_F	51_Y	1.771	0.55
67_A	70_Q	1.681	0.51
64_F	74_R	1.678	0.51
114_Q	123_N	1.655	0.50
6_Q	32_A	1.643	0.50
42_G	45_I	1.600	0.48
116_T	123_N	1.597	0.48
68_A	72_R	1.583	0.47
47_F	93_L	1.581	0.47
64_F	71_S	1.563	0.46
50_K	116_T	1.461	0.42
71_S	74_R	1.451	0.41
68_A	75_M	1.416	0.40
64_F	67_A	1.384	0.38
66_K	116_T	1.383	0.38
12_L	110_K	1.361	0.37
20_F	31_M	1.360	0.37
9_I	18_F	1.341	0.37
16_G	32_A	1.336	0.36
61_G	116_T	1.329	0.36
39_I	45_I	1.310	0.35
112_Q	119_E	1.307	0.35
22_Y	113_T	1.293	0.35
116_T	121_K	1.284	0.34
119_E	124_K	1.274	0.34
14_A	66_K	1.258	0.33
67_A	74_R	1.246	0.33
46_Y	126_K	1.234	0.32
52_V	60_E	1.233	0.32
20_F	113_T	1.198	0.31
20_F	106_I	1.180	0.30
73_R	116_T	1.179	0.30
36_V	46_Y	1.178	0.30
68_A	71_S	1.174	0.30
12_L	46_Y	1.150	0.29
121_K	125_K	1.148	0.29
5_V	12_L	1.139	0.29
27_N	30_E	1.133	0.28
51_Y	55_R	1.120	0.28
21_L	33_K	1.095	0.27
13_I	27_N	1.092	0.27
13_I	127_N	1.080	0.26
14_A	74_R	1.064	0.26
67_A	115_L	1.050	0.25
25_V	119_E	1.049	0.25
73_R	109_K	1.025	0.25
11_V	52_V	1.023	0.25
52_V	129_A	1.023	0.25
16_G	30_E	1.017	0.24
49_V	91_S	1.010	0.24
16_G	69_K	1.004	0.24
18_F	31_M	1.002	0.24
66_K	71_S	0.989	0.23
116_T	119_E	0.981	0.23
10_A	65_K	0.981	0.23
77_E	108_K	0.976	0.23
108_K	127_N	0.973	0.23
16_G	27_N	0.955	0.22
16_G	74_R	0.945	0.22
63_A	75_M	0.929	0.22
64_F	75_M	0.924	0.21
30_E	36_V	0.915	0.21
39_I	49_V	0.907	0.21
28_P	50_K	0.906	0.21
59_S	65_K	0.891	0.20
48_I	81_K	0.881	0.20
18_F	48_I	0.870	0.20
9_I	24_L	0.867	0.20
23_V	34_M	0.861	0.20
42_G	110_K	0.851	0.19
104_P	113_T	0.848	0.19
29_G	32_A	0.830	0.19
25_V	30_E	0.825	0.19
7_P	108_K	0.821	0.18
50_K	121_K	0.820	0.18
28_P	125_K	0.820	0.18
33_K	101_K	0.814	0.18
64_F	111_S	0.806	0.18
12_L	69_K	0.793	0.18
70_Q	75_M	0.785	0.17
63_A	68_A	0.784	0.17
43_I	73_R	0.773	0.17
19_G	125_K	0.764	0.17
18_F	119_E	0.737	0.16
60_E	110_K	0.734	0.16
17_A	98_S	0.724	0.16
31_M	40_V	0.721	0.16
44_I	95_S	0.720	0.16
10_A	14_A	0.718	0.16
53_M	109_K	0.710	0.16
66_K	127_N	0.705	0.16
34_M	38_V	0.702	0.15
44_I	108_K	0.699	0.15
18_F	111_S	0.697	0.15
98_S	110_K	0.682	0.15
26_T	35_A	0.679	0.15
16_G	33_K	0.675	0.15
98_S	102_P	0.671	0.15
47_F	107_L	0.664	0.15
54_N	113_T	0.663	0.15
26_T	53_M	0.661	0.15
12_L	91_S	0.659	0.14
54_N	64_F	0.654	0.14
11_V	64_F	0.649	0.14
71_S	114_Q	0.646	0.14
11_V	25_V	0.645	0.14
39_I	59_S	0.642	0.14
51_Y	113_T	0.640	0.14
13_I	92_H	0.636	0.14
18_F	92_H	0.635	0.14
116_T	125_K	0.629	0.14
7_P	22_Y	0.621	0.14
40_V	80_A	0.619	0.14
68_A	115_L	0.617	0.14
56_N	116_T	0.616	0.14
62_A	66_K	0.614	0.13
25_V	62_A	0.606	0.13
76_K	111_S	0.605	0.13
51_Y	104_P	0.602	0.13
7_P	11_V	0.602	0.13
14_A	95_S	0.602	0.13
69_K	73_R	0.599	0.13
97_P	102_P	0.593	0.13
29_G	48_I	0.592	0.13
117_V	126_K	0.584	0.13
106_I	116_T	0.582	0.13
121_K	127_N	0.581	0.13
124_K	128_R	0.581	0.13
53_M	76_K	0.580	0.13
74_R	109_K	0.579	0.13
118_I	122_K	0.574	0.13
60_E	76_K	0.571	0.13
40_V	90_V	0.571	0.13
16_G	81_K	0.567	0.13
45_I	110_K	0.566	0.13
37_T	81_K	0.566	0.13
72_R	130_L	0.565	0.13
107_L	114_Q	0.565	0.13
71_S	75_M	0.563	0.12
36_V	121_K	0.562	0.12
67_A	75_M	0.553	0.12
55_R	101_K	0.548	0.12
63_A	71_S	0.546	0.12
31_M	39_I	0.546	0.12
95_S	107_L	0.545	0.12
119_E	123_N	0.543	0.12
63_A	116_T	0.535	0.12
38_V	121_K	0.534	0.12
26_T	34_M	0.533	0.12
54_N	123_N	0.533	0.12
27_N	42_G	0.532	0.12
16_G	52_V	0.532	0.12
17_A	31_M	0.531	0.12
15_L	26_T	0.530	0.12
49_V	54_N	0.525	0.12
10_A	68_A	0.522	0.12
14_A	65_K	0.516	0.12
9_I	38_V	0.514	0.12
32_A	102_P	0.502	0.11
61_G	68_A	0.501	0.11
28_P	63_A	0.500	0.11
55_R	58_G	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pfiA	7	0.2137	43.5	0.921	Contact Map
4ev6A	3	0.4046	37.2	0.924	Contact Map
4i0uA	4	0.3893	24	0.931	Contact Map
3hzqA	3	0.4351	23.8	0.931	Contact Map
2oarA	7	0.5802	17.8	0.935	Contact Map
3bo0B	1	0.2824	17	0.935	Contact Map
4px7A	1	0.5802	15.7	0.936	Contact Map
2ww9B	1	0.2595	14.7	0.937	Contact Map
4o6yA	2	0.4046	13.2	0.938	Contact Map
4dx5A	3	0.5725	13	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.