MNTR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MNTR - Transcriptional regulator MntR

UniProt:	P54512	Sequences: MTTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEHHNQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	142 (121)
Sequences:	2658 (1743)
Seq/√Len:	158.5

ECOLI - MNTR
BACSU - MNTR
HALSA - Q9HRU8 Q9HME7 Q9HRV3 Q9HR69
SULSO - Q7LXP0 Q97WF3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_K	71_K	3.000	1.00
81_E	95_Y	2.892	1.00
84_L	101_I	2.733	1.00
97_D	106_S	2.642	1.00
11_E	77_H	2.553	1.00
93_K	108_N	2.474	1.00
75_Y	114_G	2.313	1.00
90_D	93_K	2.296	1.00
6_M	49_D	2.283	1.00
25_V	39_V	2.280	1.00
5_S	38_S	2.266	1.00
13_I	52_L	2.153	1.00
53_I	61_V	2.120	1.00
7_E	103_H	1.930	1.00
112_R	115_D	1.899	1.00
17_I	67_K	1.886	1.00
43_V	52_L	1.809	1.00
114_G	119_Y	1.719	1.00
105_L	110_I	1.716	1.00
51_Y	65_K	1.670	1.00
41_K	45_K	1.644	1.00
47_D	54_Y	1.635	1.00
15_M	74_V	1.611	1.00
64_S	67_K	1.605	1.00
72_R	107_W	1.597	1.00
34_V	39_V	1.590	1.00
99_E	103_H	1.573	1.00
82_Q	85_R	1.554	1.00
19_E	31_A	1.511	1.00
100_G	104_H	1.501	1.00
83_F	87_I	1.500	1.00
65_K	68_K	1.492	1.00
12_Q	31_A	1.459	1.00
11_E	99_E	1.438	1.00
38_S	42_M	1.434	1.00
13_I	23_A	1.433	1.00
86_I	116_L	1.396	1.00
27_D	30_E	1.351	1.00
80_L	105_L	1.348	1.00
54_Y	57_Y	1.308	1.00
83_F	116_L	1.292	1.00
17_I	23_A	1.240	1.00
7_E	102_E	1.238	1.00
99_E	102_E	1.224	1.00
43_V	60_L	1.186	1.00
12_Q	28_I	1.110	1.00
115_D	119_Y	1.102	1.00
11_E	102_E	1.091	0.99
52_L	60_L	1.089	0.99
28_I	43_V	1.078	0.99
28_I	60_L	1.069	0.99
83_F	86_I	1.059	0.99
77_H	95_Y	1.045	0.99
6_M	42_M	1.041	0.99
12_Q	32_L	1.024	0.99
72_R	76_R	1.022	0.99
4_P	8_D	1.019	0.99
36_P	42_M	1.018	0.99
8_D	103_H	1.015	0.99
15_M	31_A	1.015	0.99
40_T	54_Y	1.005	0.99
85_R	91_E	0.989	0.99
97_D	109_S	0.987	0.99
7_E	73_L	0.975	0.99
8_D	99_E	0.971	0.99
68_K	72_R	0.968	0.99
90_D	108_N	0.966	0.99
22_Y	59_G	0.965	0.99
17_I	21_G	0.965	0.99
9_Y	38_S	0.953	0.99
117_V	120_F	0.944	0.98
87_I	112_R	0.942	0.98
14_Y	74_V	0.936	0.98
89_V	109_S	0.933	0.98
89_V	97_D	0.927	0.98
77_H	102_E	0.925	0.98
26_S	36_P	0.922	0.98
80_L	113_I	0.909	0.98
75_Y	79_L	0.899	0.98
107_W	111_D	0.893	0.98
18_E	78_E	0.889	0.98
108_N	112_R	0.878	0.98
44_Q	47_D	0.878	0.98
16_L	23_A	0.859	0.97
25_V	36_P	0.858	0.97
8_D	102_E	0.830	0.97
14_Y	70_G	0.829	0.97
25_V	43_V	0.829	0.97
77_H	99_E	0.828	0.97
10_I	14_Y	0.827	0.97
25_V	40_T	0.827	0.97
14_Y	18_E	0.825	0.96
35_H	40_T	0.819	0.96
83_F	117_V	0.815	0.96
10_I	69_I	0.804	0.96
80_L	109_S	0.798	0.96
44_Q	48_K	0.777	0.95
50_E	65_K	0.757	0.94
32_L	42_M	0.752	0.94
53_I	63_T	0.743	0.94
93_K	97_D	0.743	0.94
88_G	112_R	0.736	0.93
46_L	51_Y	0.735	0.93
42_M	45_K	0.735	0.93
24_R	27_D	0.734	0.93
12_Q	15_M	0.731	0.93
29_A	34_V	0.724	0.93
7_E	11_E	0.722	0.93
76_R	107_W	0.720	0.93
76_R	110_I	0.719	0.93
94_I	99_E	0.716	0.92
6_M	44_Q	0.713	0.92
8_D	11_E	0.711	0.92
41_K	44_Q	0.695	0.91
18_E	67_K	0.691	0.91
28_I	39_V	0.687	0.91
77_H	103_H	0.683	0.91
64_S	68_K	0.683	0.91
97_D	104_H	0.681	0.90
69_I	72_R	0.680	0.90
39_V	43_V	0.676	0.90
32_L	36_P	0.674	0.90
83_F	113_I	0.670	0.90
98_V	104_H	0.668	0.90
97_D	105_L	0.663	0.89
34_V	37_S	0.661	0.89
5_S	8_D	0.660	0.89
25_V	54_Y	0.652	0.88
17_I	22_Y	0.647	0.88
13_I	39_V	0.642	0.88
105_L	109_S	0.634	0.87
14_Y	71_K	0.634	0.87
49_D	65_K	0.634	0.87
78_E	81_E	0.631	0.87
47_D	58_R	0.620	0.86
43_V	54_Y	0.619	0.86
85_R	95_Y	0.619	0.86
77_H	81_E	0.616	0.86
5_S	42_M	0.613	0.85
6_M	11_E	0.602	0.84
97_D	108_N	0.600	0.84
14_Y	67_K	0.599	0.84
73_L	76_R	0.598	0.84
34_V	38_S	0.592	0.83
16_L	27_D	0.590	0.83
65_K	69_I	0.589	0.83
76_R	106_S	0.580	0.82
97_D	100_G	0.579	0.82
24_R	59_G	0.578	0.82
8_D	41_K	0.576	0.82
87_I	116_L	0.571	0.81
82_Q	113_I	0.570	0.81
6_M	73_L	0.570	0.81
8_D	104_H	0.559	0.80
55_E	61_V	0.559	0.80
111_D	114_G	0.557	0.79
15_M	73_L	0.553	0.79
81_E	91_E	0.551	0.79
79_L	113_I	0.545	0.78
11_E	15_M	0.541	0.77
91_E	95_Y	0.541	0.77
22_Y	61_V	0.537	0.77
79_L	117_V	0.536	0.77
96_N	100_G	0.536	0.77
28_I	32_L	0.534	0.76
8_D	77_H	0.532	0.76
34_V	42_M	0.532	0.76
79_L	86_I	0.530	0.76
4_P	100_G	0.527	0.76
20_K	57_Y	0.525	0.75
74_V	78_E	0.525	0.75
82_Q	120_F	0.523	0.75
99_E	123_D	0.520	0.75
120_F	124_D	0.519	0.74
27_D	31_A	0.516	0.74
5_S	41_K	0.513	0.74
9_Y	39_V	0.513	0.74
55_E	59_G	0.512	0.73
11_E	103_H	0.507	0.73
56_K	83_F	0.502	0.72
8_D	12_Q	0.502	0.72
25_V	59_G	0.500	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1on2A	2	0.9507	99.9	0.487	Contact Map
1fx7A	4	1	99.9	0.493	Contact Map
2qq9A	2	0.9437	99.9	0.497	Contact Map
4o5vA	2	0.9859	99.9	0.504	Contact Map
3hrsA	2	0.9859	99.9	0.506	Contact Map
2x4hA	3	0.9155	99.7	0.606	Contact Map
2h09A	2	0.831	99.7	0.61	Contact Map
2p8tA	1	0.8662	99.7	0.622	Contact Map
2fxaA	4	0.8873	99.1	0.73	Contact Map
2qvoA	2	0.5634	98.9	0.75	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.