MGSR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MGSR - Regulatory protein MgsR

UniProt:	P54503	Sequences: MEQQLTFYSYPSCTSCRKTKHWLKAHQIEFNERHLFRETPTREELKYILSLTTEGIDEILATRSQTFKNLNLNIEEMTVNEVLELLIEKPKLLRRPILVDNKKLVIGYNPGELLKLSKKKTVHQSA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	126 (111)
Sequences:	2569 (1821)
Seq/√Len:	172.8

ECOLI - YFFB ARSC YFGD
BACSU - MGSR SPX YUSI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_K	30_F	3.251	1.00
42_R	84_E	2.678	1.00
49_L	83_L	2.620	1.00
36_F	91_K	2.322	1.00
9_S	32_E	2.319	1.00
7_F	20_K	2.273	1.00
98_L	113_L	2.235	1.00
100_D	103_K	2.178	1.00
42_R	46_K	2.083	1.00
11_P	34_H	1.987	1.00
46_K	83_L	1.846	1.00
34_H	37_R	1.754	1.00
66_T	89_K	1.648	1.00
22_W	108_Y	1.648	1.00
41_T	44_E	1.578	1.00
65_Q	69_N	1.563	1.00
47_Y	51_L	1.516	1.00
66_T	70_L	1.472	1.00
78_T	81_E	1.431	1.00
109_N	112_E	1.426	1.00
22_W	26_H	1.397	1.00
50_S	79_V	1.375	1.00
64_S	91_K	1.360	1.00
57_D	62_T	1.353	1.00
49_L	59_I	1.350	1.00
7_F	16_C	1.323	1.00
54_E	59_I	1.316	1.00
99_V	104_L	1.310	1.00
65_Q	68_K	1.305	1.00
58_E	63_R	1.296	1.00
45_L	87_I	1.295	1.00
33_R	39_T	1.293	1.00
8_Y	33_R	1.289	1.00
44_E	99_V	1.279	1.00
20_K	32_E	1.277	1.00
16_C	35_L	1.275	1.00
6_T	31_N	1.269	1.00
105_V	116_L	1.240	1.00
20_K	24_K	1.240	1.00
11_P	37_R	1.232	1.00
76_E	81_E	1.214	1.00
33_R	44_E	1.208	1.00
111_G	114_L	1.208	1.00
60_L	86_L	1.203	1.00
12_S	17_R	1.190	1.00
63_R	109_N	1.170	1.00
44_E	47_Y	1.158	1.00
58_E	106_I	1.146	1.00
42_R	83_L	1.132	1.00
51_L	104_L	1.122	1.00
44_E	48_I	1.122	1.00
9_S	20_K	1.108	1.00
66_T	69_N	1.101	1.00
86_L	92_L	1.085	1.00
54_E	106_I	1.081	1.00
11_P	20_K	1.078	1.00
112_E	115_K	1.060	1.00
16_C	20_K	1.053	1.00
56_I	82_V	1.043	0.99
6_T	33_R	1.038	0.99
74_I	77_M	1.031	0.99
22_W	114_L	1.018	0.99
79_V	83_L	1.015	0.99
10_Y	16_C	0.996	0.99
5_L	28_I	0.970	0.99
86_L	93_L	0.967	0.99
48_I	97_I	0.963	0.99
31_N	38_E	0.956	0.99
39_T	93_L	0.951	0.99
49_L	56_I	0.948	0.99
46_K	50_S	0.947	0.99
49_L	55_G	0.943	0.99
45_L	83_L	0.941	0.99
55_G	82_V	0.932	0.99
21_H	25_A	0.925	0.99
105_V	117_S	0.918	0.99
112_E	116_L	0.905	0.99
67_F	92_L	0.905	0.99
7_F	98_L	0.894	0.98
54_E	58_E	0.893	0.98
42_R	80_N	0.890	0.98
105_V	113_L	0.887	0.98
55_G	58_E	0.885	0.98
110_P	114_L	0.879	0.98
26_H	114_L	0.873	0.98
74_I	82_V	0.869	0.98
54_E	104_L	0.865	0.98
103_K	116_L	0.861	0.98
46_K	79_V	0.861	0.98
73_N	81_E	0.858	0.98
67_F	77_M	0.853	0.98
17_R	21_H	0.852	0.98
111_G	115_K	0.834	0.97
48_I	104_L	0.830	0.97
16_C	92_L	0.827	0.97
49_L	79_V	0.826	0.97
97_I	106_I	0.818	0.97
33_R	38_E	0.805	0.97
19_T	23_L	0.791	0.97
59_I	106_I	0.790	0.96
77_M	81_E	0.772	0.96
37_R	64_S	0.772	0.96
84_E	88_E	0.765	0.96
47_Y	99_V	0.761	0.96
70_L	85_L	0.757	0.96
98_L	105_V	0.743	0.95
46_K	80_N	0.740	0.95
79_V	82_V	0.731	0.95
72_L	75_E	0.729	0.95
113_L	117_S	0.726	0.94
35_L	93_L	0.724	0.94
35_L	97_I	0.723	0.94
7_F	23_L	0.711	0.94
43_E	46_K	0.711	0.94
77_M	82_V	0.708	0.94
24_K	29_E	0.704	0.93
64_S	69_N	0.674	0.92
73_N	77_M	0.671	0.92
14_T	21_H	0.667	0.91
10_Y	91_K	0.667	0.91
33_R	40_P	0.665	0.91
21_H	24_K	0.657	0.91
73_N	76_E	0.652	0.91
36_F	66_T	0.648	0.90
11_P	16_C	0.645	0.90
42_R	87_I	0.642	0.90
9_S	34_H	0.641	0.90
20_K	30_F	0.639	0.90
5_L	100_D	0.635	0.89
57_D	82_V	0.633	0.89
60_L	90_P	0.632	0.89
5_L	117_S	0.631	0.89
67_F	73_N	0.631	0.89
69_N	89_K	0.631	0.89
7_F	32_E	0.630	0.89
60_L	82_V	0.627	0.89
99_V	102_K	0.625	0.89
73_N	88_E	0.618	0.88
40_P	87_I	0.614	0.88
98_L	117_S	0.608	0.87
77_M	85_L	0.606	0.87
51_L	103_K	0.604	0.87
12_S	34_H	0.595	0.86
40_P	44_E	0.587	0.85
14_T	17_R	0.586	0.85
8_Y	44_E	0.582	0.85
81_E	84_E	0.579	0.85
17_R	20_K	0.579	0.85
66_T	91_K	0.576	0.84
56_I	79_V	0.575	0.84
105_V	112_E	0.573	0.84
8_Y	39_T	0.572	0.84
19_T	108_Y	0.567	0.83
54_E	97_I	0.566	0.83
71_N	75_E	0.554	0.82
15_S	64_S	0.551	0.82
13_C	95_R	0.540	0.80
59_I	97_I	0.539	0.80
19_T	113_L	0.537	0.80
24_K	27_Q	0.526	0.79
35_L	40_P	0.519	0.78
61_A	68_K	0.512	0.77
67_F	74_I	0.509	0.76
105_V	109_N	0.508	0.76
36_F	64_S	0.502	0.75
45_L	93_L	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1z3eA	1	0.9444	100	0.285	Contact Map
3l78A	1	0.9286	100	0.29	Contact Map
1s3cA	2	0.9762	100	0.296	Contact Map
3fz4A	1	0.9206	100	0.299	Contact Map
3gkxA	2	0.9286	100	0.305	Contact Map
2mu0A	1	0.9286	100	0.307	Contact Map
3f0iA	1	0.9127	100	0.316	Contact Map
3rdwA	1	0.9048	100	0.317	Contact Map
2kokA	1	0.9206	100	0.323	Contact Map
2m46A	1	0.9127	100	0.326	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.