YQGY - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQGY - Uncharacterized protein YqgY

UniProt:	P54502	Sequences: MNRMFRVLGFWTGIFAVMFYLGDMKDASLLFFGQTILFVFLSYLNLTERMYIYIFGAYLTIFFAGFTYYSIFIMVPGGGGH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	81 (75)
Sequences:	114 (55)
Seq/√Len:	6.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_G	39_V	5.396	0.99
3_R	6_R	3.712	0.92
3_R	34_Q	2.379	0.62
19_F	24_M	2.092	0.51
69_Y	73_I	2.084	0.51
2_N	45_N	1.997	0.48
2_N	19_F	1.843	0.42
34_Q	43_Y	1.839	0.42
6_R	34_Q	1.803	0.41
44_L	47_T	1.712	0.38
20_Y	37_L	1.661	0.36
35_T	46_L	1.587	0.34
34_Q	58_Y	1.567	0.33
13_G	17_V	1.556	0.33
16_A	32_F	1.532	0.32
2_N	43_Y	1.443	0.29
56_G	60_T	1.387	0.27
5_F	21_L	1.376	0.27
32_F	52_I	1.370	0.27
43_Y	47_T	1.370	0.27
12_T	67_T	1.345	0.26
17_V	62_F	1.339	0.26
38_F	50_M	1.313	0.25
20_Y	28_S	1.235	0.23
4_M	7_V	1.227	0.23
41_L	63_F	1.208	0.23
5_F	36_I	1.193	0.22
21_L	33_G	1.154	0.21
67_T	71_I	1.149	0.21
3_R	7_V	1.134	0.21
11_W	24_M	1.107	0.20
15_F	19_F	1.092	0.20
32_F	37_L	1.088	0.20
9_G	40_F	1.075	0.19
14_I	17_V	1.073	0.19
13_G	75_V	1.059	0.19
21_L	64_A	1.057	0.19
30_L	65_G	1.052	0.19
25_K	28_S	0.988	0.17
36_I	40_F	0.973	0.17
5_F	70_S	0.953	0.17
44_L	61_I	0.927	0.16
6_R	74_M	0.916	0.16
33_G	47_T	0.911	0.16
27_A	31_F	0.893	0.16
3_R	74_M	0.869	0.15
4_M	29_L	0.866	0.15
30_L	39_V	0.852	0.15
69_Y	74_M	0.852	0.15
19_F	27_A	0.842	0.15
13_G	53_Y	0.839	0.15
44_L	75_V	0.825	0.14
7_V	31_F	0.820	0.14
52_I	74_M	0.810	0.14
6_R	32_F	0.807	0.14
56_G	62_F	0.795	0.14
23_D	69_Y	0.784	0.14
18_M	54_I	0.782	0.14
54_I	67_T	0.782	0.14
7_V	42_S	0.777	0.13
53_Y	56_G	0.771	0.13
32_F	74_M	0.770	0.13
64_A	69_Y	0.765	0.13
18_M	75_V	0.757	0.13
13_G	59_L	0.746	0.13
27_A	64_A	0.739	0.13
41_L	74_M	0.712	0.12
53_Y	62_F	0.711	0.12
32_F	42_S	0.702	0.12
15_F	42_S	0.701	0.12
18_M	32_F	0.700	0.12
57_A	60_T	0.699	0.12
6_R	31_F	0.695	0.12
5_F	63_F	0.694	0.12
5_F	42_S	0.694	0.12
9_G	41_L	0.691	0.12
54_I	59_L	0.683	0.12
8_L	34_Q	0.679	0.12
8_L	23_D	0.674	0.12
54_I	71_I	0.656	0.12
3_R	43_Y	0.643	0.11
25_K	70_S	0.642	0.11
3_R	31_F	0.634	0.11
3_R	32_F	0.625	0.11
32_F	36_I	0.623	0.11
13_G	62_F	0.622	0.11
58_Y	72_F	0.620	0.11
40_F	64_A	0.615	0.11
53_Y	71_I	0.615	0.11
43_Y	68_Y	0.611	0.11
17_V	75_V	0.608	0.11
21_L	27_A	0.602	0.11
8_L	43_Y	0.599	0.11
59_L	71_I	0.586	0.11
57_A	62_F	0.586	0.11
8_L	63_F	0.572	0.10
11_W	62_F	0.558	0.10
32_F	49_R	0.557	0.10
28_S	58_Y	0.556	0.10
29_L	45_N	0.546	0.10
42_S	69_Y	0.542	0.10
22_G	72_F	0.532	0.10
21_L	57_A	0.531	0.10
55_F	58_Y	0.531	0.10
15_F	50_M	0.530	0.10
18_M	52_I	0.527	0.10
53_Y	59_L	0.519	0.10
29_L	68_Y	0.518	0.10
12_T	70_S	0.518	0.10
2_N	11_W	0.514	0.10
16_A	52_I	0.507	0.09
38_F	59_L	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hfiA	3	0.3086	2.3	0.952	Contact Map
4i0uA	4	0.7654	1.8	0.954	Contact Map
2m6bA	1	0.4568	1.5	0.956	Contact Map
2mawA	1	0.4198	1.3	0.958	Contact Map
4ev6A	3	0.7901	1.2	0.958	Contact Map
2wpxA	1	0.321	1.2	0.959	Contact Map
2pm7A	2	0.1111	0.9	0.963	Contact Map
2llyA	1	0.4321	0.8	0.963	Contact Map
2h8aA	3	0.2963	0.7	0.964	Contact Map
4aw6A	2	0.8519	0.7	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.