YQGV - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQGV - UPF0045 protein YqgV

UniProt:	P54499	Sequences: MAIADVTIIPIGTETPSVSAYVADVQKILEGYQAEGKIKYQLTPMNTLIEGELSDLFAVIQAIHEAPFQKGLHRVATNIRIDDRRDKKTTLESKIESVNKHLQP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	104 (96)
Sequences:	534 (355)
Seq/√Len:	36.2

BACSU - YQGV
HALSA - Q9HNZ4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
89_T	93_S	3.671	1.00
96_E	100_K	3.162	1.00
43_T	48_L	2.918	1.00
54_S	61_Q	2.877	1.00
39_K	92_E	2.431	1.00
60_I	79_I	2.184	0.99
44_P	91_L	2.146	0.99
76_A	80_R	2.044	0.99
4_A	60_I	2.009	0.98
90_T	93_S	1.887	0.98
38_I	49_I	1.873	0.98
45_M	82_D	1.839	0.97
19_S	101_H	1.835	0.97
68_F	85_R	1.793	0.97
28_I	66_A	1.790	0.97
64_H	77_T	1.729	0.96
6_V	60_I	1.710	0.96
97_S	101_H	1.672	0.95
5_D	80_R	1.651	0.95
9_I	76_A	1.643	0.95
92_E	96_E	1.634	0.95
6_V	63_I	1.468	0.91
27_K	102_L	1.468	0.91
6_V	49_I	1.457	0.90
41_Q	92_E	1.440	0.90
26_Q	40_Y	1.436	0.90
13_T	16_P	1.407	0.89
55_D	58_A	1.403	0.89
57_F	81_I	1.394	0.88
31_G	62_A	1.369	0.87
4_A	56_L	1.312	0.85
68_F	83_D	1.311	0.85
25_V	63_I	1.262	0.83
29_L	59_V	1.258	0.82
3_I	91_L	1.220	0.80
96_E	99_N	1.113	0.74
77_T	81_I	1.107	0.74
37_K	55_D	1.096	0.73
53_L	56_L	1.083	0.72
69_Q	79_I	1.060	0.70
38_I	56_L	1.058	0.70
24_D	70_K	1.043	0.69
26_Q	42_L	1.033	0.68
25_V	67_P	1.032	0.68
52_E	61_Q	1.031	0.68
8_I	25_V	1.022	0.67
58_A	62_A	1.017	0.67
44_P	48_L	0.966	0.63
43_T	82_D	0.965	0.63
67_P	97_S	0.960	0.62
42_L	98_V	0.959	0.62
19_S	97_S	0.944	0.61
24_D	27_K	0.939	0.61
9_I	29_L	0.932	0.60
9_I	77_T	0.916	0.59
36_G	59_V	0.912	0.58
58_A	61_Q	0.910	0.58
22_V	87_K	0.908	0.58
30_E	102_L	0.891	0.57
9_I	78_N	0.876	0.55
28_I	63_I	0.861	0.54
21_Y	72_L	0.860	0.54
2_A	51_G	0.851	0.53
68_F	82_D	0.847	0.53
9_I	22_V	0.839	0.52
5_D	48_L	0.826	0.51
45_M	48_L	0.821	0.51
54_S	81_I	0.816	0.50
45_M	94_K	0.814	0.50
64_H	83_D	0.809	0.50
30_E	99_N	0.808	0.49
31_G	70_K	0.796	0.48
24_D	54_S	0.796	0.48
57_F	60_I	0.792	0.48
14_E	51_G	0.783	0.47
3_I	79_I	0.775	0.47
7_T	94_K	0.767	0.46
88_K	100_K	0.766	0.46
71_G	86_D	0.763	0.46
12_G	17_S	0.742	0.44
43_T	46_N	0.718	0.42
4_A	49_I	0.717	0.42
28_I	88_K	0.716	0.41
52_E	55_D	0.712	0.41
30_E	40_Y	0.709	0.41
11_I	76_A	0.708	0.41
68_F	75_V	0.705	0.41
45_M	85_R	0.703	0.40
28_I	62_A	0.700	0.40
86_D	90_T	0.700	0.40
14_E	72_L	0.697	0.40
53_L	57_F	0.695	0.40
6_V	80_R	0.692	0.39
27_K	31_G	0.691	0.39
40_Y	59_V	0.686	0.39
16_P	73_H	0.684	0.39
62_A	66_A	0.677	0.38
20_A	101_H	0.674	0.38
5_D	26_Q	0.668	0.37
28_I	51_G	0.663	0.37
9_I	12_G	0.663	0.37
48_L	82_D	0.661	0.37
23_A	94_K	0.658	0.37
4_A	44_P	0.657	0.37
46_N	49_I	0.652	0.36
69_Q	92_E	0.646	0.36
13_T	49_I	0.646	0.36
18_V	94_K	0.645	0.36
6_V	79_I	0.635	0.35
39_K	50_E	0.624	0.34
75_V	85_R	0.618	0.34
13_T	71_G	0.615	0.33
75_V	83_D	0.608	0.33
43_T	67_P	0.605	0.32
19_S	91_L	0.605	0.32
69_Q	95_I	0.600	0.32
3_I	22_V	0.598	0.32
67_P	72_L	0.591	0.31
5_D	46_N	0.583	0.31
54_S	58_A	0.581	0.31
23_A	97_S	0.575	0.30
25_V	77_T	0.574	0.30
22_V	70_K	0.573	0.30
39_K	86_D	0.563	0.29
36_G	55_D	0.562	0.29
2_A	54_S	0.560	0.29
7_T	45_M	0.558	0.29
26_Q	29_L	0.552	0.29
18_V	82_D	0.552	0.29
11_I	59_V	0.552	0.29
30_E	88_K	0.551	0.29
80_R	94_K	0.550	0.28
40_Y	81_I	0.550	0.28
2_A	56_L	0.545	0.28
12_G	48_L	0.543	0.28
6_V	29_L	0.542	0.28
13_T	24_D	0.532	0.27
71_G	83_D	0.521	0.26
56_L	63_I	0.509	0.26
11_I	19_S	0.506	0.25
59_V	66_A	0.506	0.25
25_V	66_A	0.505	0.25
18_V	45_M	0.503	0.25
20_A	70_K	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1lxjA	4	0.9615	100	0.221	Contact Map
1lxnA	4	0.9423	100	0.223	Contact Map
1yqhA	3	0.9423	100	0.261	Contact Map
2epiA	4	0.9135	100	0.274	Contact Map
1vk8A	4	0.8846	100	0.277	Contact Map
2iboA	4	0.8558	100	0.308	Contact Map
1s99A	2	0.8077	99.8	0.564	Contact Map
1knvA	4	0.9423	27.9	0.926	Contact Map
3tc3A	1	0.9423	24.4	0.929	Contact Map
3c1mA	3	0.6346	22.7	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.