YQGQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQGQ - Uncharacterized protein YqgQ

UniProt:	P54494	Sequences: MNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQTKNGRDFYKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	71 (65)
Sequences:	251 (163)
Seq/√Len:	20.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_Y	9_Q	3.369	1.00
44_E	47_Q	2.696	0.98
4_F	54_V	2.664	0.98
35_K	52_A	2.485	0.97
10_L	43_I	2.044	0.92
31_L	35_K	1.999	0.91
4_F	7_V	1.920	0.89
50_R	54_V	1.868	0.88
21_G	28_E	1.783	0.85
19_Y	30_M	1.675	0.81
4_F	59_L	1.556	0.76
8_Q	30_M	1.552	0.76
4_F	8_Q	1.491	0.73
14_F	43_I	1.470	0.72
19_Y	37_L	1.438	0.70
12_K	17_I	1.437	0.70
31_L	52_A	1.426	0.70
20_F	29_F	1.417	0.69
5_Y	16_H	1.389	0.67
38_Y	45_K	1.333	0.64
56_R	61_Q	1.308	0.63
10_L	34_L	1.291	0.62
55_L	59_L	1.281	0.61
8_Q	21_G	1.210	0.57
5_Y	34_L	1.200	0.56
53_A	56_R	1.180	0.55
4_F	27_I	1.174	0.54
30_M	51_A	1.145	0.52
42_M	65_G	1.129	0.51
59_L	63_K	1.111	0.50
7_V	10_L	1.089	0.49
27_I	59_L	1.072	0.48
27_I	55_L	1.039	0.45
32_D	35_K	1.030	0.45
24_E	59_L	0.996	0.43
23_R	58_E	0.964	0.41
13_T	56_R	0.957	0.40
14_F	21_G	0.927	0.38
18_V	22_D	0.914	0.38
20_F	25_L	0.902	0.37
22_D	25_L	0.875	0.35
22_D	27_I	0.859	0.34
24_E	62_T	0.857	0.34
7_V	18_V	0.834	0.33
13_T	17_I	0.814	0.32
13_T	57_K	0.807	0.31
31_L	56_R	0.801	0.31
26_E	48_W	0.791	0.30
19_Y	25_L	0.787	0.30
12_K	37_L	0.786	0.30
3_T	9_Q	0.785	0.30
34_L	51_A	0.780	0.30
26_E	29_F	0.774	0.29
34_L	63_K	0.768	0.29
2_N	57_K	0.768	0.29
17_I	60_E	0.766	0.29
57_K	61_Q	0.764	0.29
22_D	48_W	0.758	0.29
19_Y	51_A	0.755	0.28
54_V	64_N	0.747	0.28
20_F	26_E	0.740	0.28
35_K	45_K	0.730	0.27
19_Y	36_E	0.725	0.27
18_V	34_L	0.720	0.27
9_Q	34_L	0.706	0.26
31_L	63_K	0.699	0.26
45_K	49_A	0.697	0.25
6_D	10_L	0.695	0.25
23_R	62_T	0.689	0.25
4_F	30_M	0.668	0.24
53_A	64_N	0.665	0.24
43_I	51_A	0.661	0.24
4_F	16_H	0.655	0.23
22_D	32_D	0.637	0.23
49_A	52_A	0.627	0.22
3_T	64_N	0.626	0.22
46_E	50_R	0.624	0.22
20_F	34_L	0.596	0.21
8_Q	34_L	0.596	0.21
20_F	55_L	0.592	0.21
10_L	42_M	0.588	0.20
13_T	47_Q	0.584	0.20
43_I	61_Q	0.579	0.20
13_T	20_F	0.578	0.20
4_F	10_L	0.577	0.20
13_T	42_M	0.563	0.19
3_T	34_L	0.560	0.19
40_N	65_G	0.552	0.19
29_F	56_R	0.548	0.19
11_L	18_V	0.543	0.19
35_K	55_L	0.542	0.19
41_H	53_A	0.535	0.18
23_R	39_M	0.523	0.18
31_L	50_R	0.523	0.18
11_L	53_A	0.519	0.18
16_H	57_K	0.516	0.18
8_Q	19_Y	0.515	0.18
5_Y	8_Q	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2nn4A	1	0.8732	100	0.076	Contact Map
2obbA	2	0.6761	15.4	0.909	Contact Map
4v33A	1	0.9718	15.3	0.91	Contact Map
3l7yA	1	0.831	14.3	0.911	Contact Map
3n28A	1	0.9296	14.2	0.911	Contact Map
3daoA	1	0.8028	13.6	0.912	Contact Map
1l6rA	2	0.7887	12.9	0.912	Contact Map
4ofzA	2	0.9296	10.5	0.916	Contact Map
3fzqA	2	0.7465	10	0.917	Contact Map
2klzA	1	0.4366	9.5	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.