YQGC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQGC - Uncharacterized protein YqgC

UniProt:	P54486	Sequences: MDMLYWLLIAAVFIIAFIGLVYPVIPSVVFIVAGFVLYGFLFSFSPYSYMFWLVEAVFAAVLFAADYVSNLLGVKRFGGSKAAIWGSTIGLLIGPFVIPVAGIILGPFIGAVCAELIVHQKDLKSAFKIGLGSLIGFLTGVIAKGIIQLLMIGYFLWTVL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (152)
Sequences:	758 (568)
Seq/√Len:	46.1

BACSU - YQGC
HALSA - Q9HQI0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
112_V	130_G	5.384	1.00
49_Y	53_L	3.776	1.00
66_D	144_K	3.237	1.00
86_G	114_A	3.109	1.00
60_A	64_A	2.522	1.00
127_F	131_L	2.505	1.00
112_V	123_L	2.493	1.00
85_W	89_I	2.492	1.00
86_G	110_G	2.468	1.00
50_M	53_L	2.420	1.00
80_S	83_A	2.382	1.00
129_I	133_S	2.368	1.00
74_V	79_G	2.118	1.00
55_E	151_M	2.070	1.00
108_F	155_F	2.066	1.00
53_L	57_V	2.054	0.99
110_G	114_A	1.921	0.99
106_G	110_G	1.894	0.99
132_G	136_G	1.887	0.99
77_F	132_G	1.844	0.99
15_I	18_I	1.821	0.99
14_I	18_I	1.794	0.99
122_D	125_S	1.786	0.99
86_G	111_A	1.785	0.99
77_F	131_L	1.776	0.98
51_F	154_Y	1.764	0.98
8_L	105_L	1.760	0.98
20_L	145_G	1.618	0.97
96_F	99_P	1.616	0.97
51_F	55_E	1.605	0.97
43_S	46_P	1.590	0.97
121_K	125_S	1.552	0.96
13_F	152_I	1.539	0.96
91_L	133_S	1.525	0.96
133_S	137_F	1.436	0.94
93_I	113_C	1.431	0.94
82_A	85_W	1.422	0.94
21_V	157_W	1.417	0.94
111_A	114_A	1.398	0.94
73_G	111_A	1.355	0.93
129_I	141_V	1.332	0.92
141_V	145_G	1.325	0.92
105_L	109_I	1.311	0.91
35_F	155_F	1.281	0.90
73_G	136_G	1.257	0.89
94_G	99_P	1.228	0.88
36_V	56_A	1.218	0.88
53_L	56_A	1.209	0.87
33_A	37_L	1.198	0.87
4_L	8_L	1.193	0.87
90_G	110_G	1.193	0.87
129_I	136_G	1.179	0.86
16_A	19_G	1.169	0.86
79_G	132_G	1.161	0.85
16_A	31_I	1.144	0.84
103_I	149_L	1.143	0.84
3_M	92_L	1.142	0.84
109_I	113_C	1.114	0.83
79_G	137_F	1.112	0.83
111_A	130_G	1.107	0.82
88_T	91_L	1.098	0.82
105_L	129_I	1.088	0.81
129_I	132_G	1.083	0.81
18_I	24_V	1.070	0.80
21_V	145_G	1.066	0.80
16_A	148_Q	1.064	0.80
50_M	64_A	1.059	0.79
32_V	36_V	1.049	0.79
81_K	85_W	1.044	0.78
81_K	113_C	1.020	0.77
112_V	116_L	1.016	0.76
31_I	152_I	0.996	0.75
101_A	105_L	0.990	0.75
5_Y	41_L	0.983	0.74
54_V	93_I	0.981	0.74
19_G	27_S	0.978	0.74
3_M	142_I	0.972	0.73
9_I	38_Y	0.971	0.73
80_S	155_F	0.971	0.73
140_G	144_K	0.969	0.73
17_F	149_L	0.964	0.73
86_G	136_G	0.962	0.72
16_A	27_S	0.960	0.72
9_I	12_V	0.956	0.72
142_I	146_I	0.947	0.71
18_I	22_Y	0.931	0.70
15_I	30_F	0.920	0.69
3_M	7_L	0.912	0.68
5_Y	37_L	0.902	0.67
116_L	129_I	0.896	0.67
8_L	36_V	0.886	0.66
96_F	107_P	0.884	0.66
28_V	62_L	0.883	0.66
13_F	154_Y	0.878	0.65
94_G	106_G	0.877	0.65
4_L	12_V	0.870	0.65
82_A	86_G	0.867	0.64
112_V	127_F	0.859	0.64
62_L	104_I	0.854	0.63
16_A	25_I	0.849	0.63
73_G	86_G	0.849	0.63
86_G	90_G	0.845	0.62
6_W	38_Y	0.835	0.61
11_A	116_L	0.831	0.61
20_L	28_V	0.827	0.61
56_A	145_G	0.825	0.60
42_F	76_R	0.820	0.60
71_L	84_I	0.815	0.60
47_Y	51_F	0.802	0.58
11_A	124_K	0.797	0.58
107_P	126_A	0.788	0.57
80_S	129_I	0.787	0.57
104_I	138_L	0.784	0.57
15_I	117_I	0.777	0.56
62_L	148_Q	0.771	0.55
13_F	155_F	0.766	0.55
28_V	148_Q	0.760	0.54
73_G	114_A	0.757	0.54
140_G	143_A	0.755	0.54
8_L	97_V	0.754	0.54
31_I	156_L	0.754	0.54
39_G	43_S	0.749	0.53
13_F	31_I	0.740	0.52
122_D	146_I	0.737	0.52
79_G	133_S	0.737	0.52
32_V	101_A	0.735	0.52
25_I	67_Y	0.734	0.52
83_A	140_G	0.732	0.51
59_A	151_M	0.728	0.51
12_V	88_T	0.727	0.51
124_K	127_F	0.725	0.51
92_L	121_K	0.715	0.50
64_A	68_V	0.711	0.49
31_I	148_Q	0.707	0.49
83_A	133_S	0.705	0.49
9_I	34_G	0.705	0.49
31_I	35_F	0.702	0.49
70_N	74_V	0.701	0.48
90_G	132_G	0.698	0.48
37_L	144_K	0.697	0.48
107_P	132_G	0.696	0.48
87_S	111_A	0.693	0.48
126_A	148_Q	0.690	0.47
113_C	117_I	0.685	0.47
42_F	52_W	0.683	0.47
24_V	97_V	0.683	0.47
76_R	150_L	0.680	0.46
60_A	89_I	0.679	0.46
6_W	20_L	0.679	0.46
14_I	29_V	0.679	0.46
82_A	129_I	0.677	0.46
21_V	76_R	0.667	0.45
96_F	157_W	0.667	0.45
57_V	135_I	0.661	0.45
42_F	46_P	0.658	0.44
36_V	121_K	0.654	0.44
11_A	15_I	0.651	0.44
149_L	153_G	0.651	0.44
122_D	156_L	0.647	0.43
129_I	142_I	0.643	0.43
21_V	117_I	0.643	0.43
133_S	146_I	0.638	0.42
17_F	20_L	0.636	0.42
15_I	58_F	0.636	0.42
68_V	93_I	0.635	0.42
10_A	67_Y	0.634	0.42
4_L	7_L	0.632	0.42
86_G	132_G	0.628	0.41
51_F	155_F	0.623	0.41
142_I	156_L	0.622	0.41
50_M	57_V	0.621	0.41
12_V	33_A	0.615	0.40
72_L	149_L	0.615	0.40
23_P	26_P	0.614	0.40
52_W	148_Q	0.614	0.40
35_F	59_A	0.612	0.40
29_V	140_G	0.612	0.40
28_V	133_S	0.611	0.40
3_M	57_V	0.604	0.39
73_G	110_G	0.599	0.39
89_I	117_I	0.599	0.39
35_F	108_F	0.598	0.39
13_F	38_Y	0.596	0.38
134_L	153_G	0.592	0.38
82_A	117_I	0.590	0.38
54_V	154_Y	0.587	0.37
48_S	56_A	0.586	0.37
14_I	146_I	0.585	0.37
64_A	93_I	0.582	0.37
59_A	62_L	0.579	0.37
28_V	149_L	0.576	0.36
123_L	127_F	0.573	0.36
22_Y	95_P	0.572	0.36
82_A	111_A	0.572	0.36
57_V	146_I	0.572	0.36
45_S	60_A	0.568	0.36
27_S	110_G	0.567	0.36
73_G	132_G	0.559	0.35
53_L	117_I	0.558	0.35
38_Y	151_M	0.557	0.35
77_F	129_I	0.556	0.35
54_V	121_K	0.555	0.35
108_F	130_G	0.553	0.34
125_S	129_I	0.541	0.33
65_A	71_L	0.538	0.33
77_F	83_A	0.537	0.33
28_V	59_A	0.532	0.33
14_I	149_L	0.531	0.32
55_E	59_A	0.531	0.32
87_S	100_V	0.528	0.32
61_V	143_A	0.527	0.32
8_L	60_A	0.524	0.32
22_Y	91_L	0.524	0.32
14_I	64_A	0.523	0.32
113_C	123_L	0.519	0.31
83_A	86_G	0.518	0.31
34_G	152_I	0.518	0.31
57_V	89_I	0.518	0.31
124_K	153_G	0.514	0.31
76_R	108_F	0.510	0.31
40_F	60_A	0.508	0.31
30_F	68_V	0.507	0.30
25_I	109_I	0.507	0.30
113_C	125_S	0.505	0.30
4_L	123_L	0.504	0.30
70_N	79_G	0.504	0.30
13_F	148_Q	0.504	0.30
32_V	104_I	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jlnA	1	0.95	10.1	0.942	Contact Map
2nwlA	3	0.5125	9.8	0.942	Contact Map
4z7fA	2	0.7375	4.8	0.95	Contact Map
3rlbA	1	0.8	4.1	0.952	Contact Map
4mt1A	3	0.725	3.3	0.954	Contact Map
2jwaA	2	0.2562	3.3	0.954	Contact Map
3p5nA	2	0.6625	3.3	0.954	Contact Map
2zy9A	2	0.35	2.4	0.957	Contact Map
4dveA	3	0.7875	2.3	0.957	Contact Map
3rceA	1	0.875	2.2	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.