YQFZ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQFZ - Uncharacterized protein YqfZ

UniProt:	P54483	Sequences: MKRLTLVCSIVFILFILFYDLKIGTIPIQDLPVYEASAKTAVQEPAYKTVKVKPGDTVMSIVGSAGSPDDIVKDFEALNPNVKANAIQAGTAYKFPVYP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	99 (76)
Sequences:	548 (521)
Seq/√Len:	59.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
75_F	93_Y	3.354	1.00
50_V	61_I	3.233	1.00
50_V	56_D	3.198	1.00
52_V	93_Y	2.990	1.00
50_V	65_A	2.918	1.00
58_V	94_K	2.539	1.00
71_I	74_D	2.518	1.00
58_V	84_A	2.239	1.00
84_A	94_K	2.152	1.00
42_V	49_T	1.902	1.00
51_K	92_A	1.656	0.99
59_M	63_G	1.654	0.99
58_V	76_E	1.629	0.99
46_A	94_K	1.570	0.99
56_D	61_I	1.504	0.98
57_T	60_S	1.466	0.98
72_V	76_E	1.456	0.98
52_V	61_I	1.404	0.97
76_E	81_N	1.375	0.97
46_A	58_V	1.227	0.94
57_T	62_V	1.225	0.94
67_S	78_L	1.220	0.94
36_A	92_A	1.201	0.93
78_L	95_F	1.195	0.93
61_I	87_I	1.193	0.93
32_P	35_E	1.161	0.92
39_K	42_V	1.157	0.92
62_V	72_V	1.141	0.91
74_D	77_A	1.121	0.90
76_E	85_N	1.120	0.90
62_V	67_S	1.101	0.89
50_V	53_K	1.093	0.89
56_D	60_S	1.089	0.89
52_V	55_G	1.089	0.89
82_V	85_N	1.089	0.89
67_S	75_F	1.049	0.87
20_D	26_I	1.047	0.87
74_D	78_L	1.042	0.87
51_K	91_T	1.014	0.85
73_K	77_A	1.010	0.85
88_Q	91_T	0.991	0.84
67_S	74_D	0.983	0.83
58_V	72_V	0.945	0.81
65_A	95_F	0.941	0.80
53_K	56_D	0.925	0.79
17_L	27_P	0.917	0.79
34_Y	42_V	0.914	0.79
34_Y	49_T	0.896	0.77
20_D	32_P	0.875	0.75
41_A	49_T	0.850	0.73
35_E	39_K	0.843	0.73
81_N	84_A	0.830	0.71
34_Y	44_E	0.819	0.70
81_N	85_N	0.799	0.69
39_K	93_Y	0.788	0.68
26_I	29_Q	0.782	0.67
63_G	73_K	0.775	0.66
46_A	95_F	0.762	0.65
59_M	89_A	0.760	0.65
62_V	65_A	0.754	0.64
83_K	86_A	0.752	0.64
80_P	93_Y	0.749	0.64
18_F	27_P	0.749	0.64
19_Y	22_K	0.746	0.63
32_P	44_E	0.724	0.61
52_V	56_D	0.722	0.61
27_P	33_V	0.716	0.60
49_T	92_A	0.699	0.58
46_A	84_A	0.682	0.56
22_K	40_T	0.679	0.56
20_D	45_P	0.671	0.55
59_M	62_V	0.670	0.55
25_T	37_S	0.670	0.55
57_T	79_N	0.662	0.54
19_Y	23_I	0.650	0.53
50_V	93_Y	0.649	0.53
54_P	89_A	0.647	0.52
49_T	78_L	0.646	0.52
41_A	47_Y	0.644	0.52
51_K	90_G	0.636	0.51
50_V	64_S	0.628	0.50
42_V	47_Y	0.621	0.50
49_T	75_F	0.603	0.48
67_S	71_I	0.593	0.46
80_P	94_K	0.592	0.46
21_L	27_P	0.590	0.46
50_V	57_T	0.584	0.45
52_V	64_S	0.581	0.45
81_N	87_I	0.580	0.45
67_S	95_F	0.577	0.45
18_F	26_I	0.576	0.45
67_S	93_Y	0.576	0.45
59_M	91_T	0.572	0.44
28_I	33_V	0.572	0.44
55_G	64_S	0.558	0.43
24_G	73_K	0.554	0.42
90_G	93_Y	0.551	0.42
18_F	28_I	0.548	0.41
46_A	49_T	0.544	0.41
81_N	86_A	0.535	0.40
72_V	75_F	0.534	0.40
50_V	75_F	0.530	0.40
33_V	72_V	0.526	0.39
40_T	44_E	0.525	0.39
56_D	64_S	0.520	0.38
18_F	25_T	0.518	0.38
21_L	85_N	0.511	0.38
47_Y	76_E	0.511	0.38
21_L	26_I	0.510	0.37
18_F	66_G	0.510	0.37
18_F	22_K	0.510	0.37
53_K	64_S	0.508	0.37
76_E	80_P	0.501	0.36
26_I	33_V	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4b8vA	2	0.5556	99.5	0.401	Contact Map
4pxvA	1	0.4848	99.2	0.483	Contact Map
2mkxA	1	0.5152	99.1	0.504	Contact Map
2djpA	1	0.6465	99.1	0.505	Contact Map
4xcmA	2	0.4848	99.1	0.506	Contact Map
4ebyA	1	0.5556	99	0.517	Contact Map
2l9yA	1	0.8788	99	0.522	Contact Map
4a1kA	2	0.5051	98.9	0.544	Contact Map
2mpwA	1	0.7374	98.9	0.547	Contact Map
1e0gA	1	0.4848	98.9	0.55	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.