YQFX - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQFX - Uncharacterized protein YqfX

UniProt:	P54481	Sequences: MKVANDYEKRDNNSYYVDHGSEGTNITRDNDGFFEETAAEIAEPYRAADRSNDQDNDRSGGNVNEGRGIGYIALALSIISLFVLPVLLGAAGIIVGYIARRRGAQGLGAWAMGIGVVSLVLGIFIIPFF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	129 (111)
Sequences:	160 (137)
Seq/√Len:	13.0

BACSU - YQFX

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_S	92_G	7.342	1.00
65_E	69_I	3.126	0.97
92_G	111_A	2.856	0.95
80_S	118_S	2.812	0.95
97_Y	112_M	2.755	0.94
42_A	101_R	2.511	0.91
35_E	128_F	2.222	0.85
113_G	117_V	2.182	0.84
71_Y	106_G	2.104	0.81
86_V	128_F	2.078	0.80
99_A	109_A	2.058	0.80
68_G	83_V	2.048	0.79
81_L	114_I	2.030	0.79
90_A	119_L	1.641	0.62
67_R	104_A	1.607	0.61
88_L	95_V	1.579	0.59
73_A	87_L	1.577	0.59
78_I	81_L	1.572	0.59
79_I	94_I	1.534	0.57
89_G	114_I	1.495	0.55
97_Y	126_I	1.457	0.53
77_S	119_L	1.414	0.51
92_G	119_L	1.405	0.50
114_I	122_G	1.392	0.49
100_R	122_G	1.348	0.47
26_I	31_D	1.335	0.47
77_S	122_G	1.317	0.46
71_Y	75_A	1.305	0.45
121_L	126_I	1.287	0.44
77_S	85_P	1.259	0.43
86_V	100_R	1.256	0.42
86_V	113_G	1.244	0.42
69_I	72_I	1.242	0.42
100_R	115_G	1.197	0.39
79_I	104_A	1.187	0.39
66_G	113_G	1.178	0.38
110_W	114_I	1.171	0.38
57_D	60_G	1.162	0.38
64_N	76_L	1.161	0.38
47_A	58_R	1.148	0.37
49_D	57_D	1.110	0.35
79_I	120_V	1.109	0.35
76_L	91_A	1.100	0.35
83_V	88_L	1.090	0.34
35_E	89_G	1.060	0.33
81_L	110_W	1.053	0.33
73_A	128_F	1.046	0.32
18_D	21_S	1.032	0.32
71_Y	123_I	1.031	0.32
25_N	28_R	1.020	0.31
90_A	100_R	1.015	0.31
71_Y	122_G	0.999	0.30
93_I	98_I	0.997	0.30
74_L	99_A	0.994	0.30
68_G	119_L	0.992	0.30
50_R	65_E	0.968	0.29
99_A	122_G	0.965	0.29
30_N	104_A	0.956	0.28
118_S	122_G	0.950	0.28
33_F	114_I	0.927	0.27
94_I	120_V	0.913	0.26
109_A	123_I	0.895	0.26
61_G	80_S	0.885	0.25
32_G	60_G	0.880	0.25
54_Q	60_G	0.877	0.25
84_L	114_I	0.876	0.25
79_I	102_R	0.873	0.25
80_S	122_G	0.869	0.25
35_E	38_A	0.861	0.24
79_I	121_L	0.860	0.24
101_R	110_W	0.852	0.24
50_R	60_G	0.850	0.24
106_G	109_A	0.844	0.24
117_V	124_F	0.839	0.24
59_S	62_N	0.839	0.24
27_T	30_N	0.838	0.24
38_A	91_A	0.831	0.23
68_G	101_R	0.828	0.23
90_A	114_I	0.827	0.23
124_F	128_F	0.825	0.23
33_F	81_L	0.822	0.23
81_L	89_G	0.820	0.23
113_G	128_F	0.813	0.23
93_I	100_R	0.811	0.23
22_E	25_N	0.807	0.22
81_L	86_V	0.803	0.22
41_I	64_N	0.786	0.22
17_V	32_G	0.779	0.21
36_E	96_G	0.779	0.21
96_G	108_G	0.779	0.21
36_E	108_G	0.779	0.21
48_A	56_N	0.776	0.21
21_S	24_T	0.775	0.21
104_A	123_I	0.769	0.21
74_L	97_Y	0.769	0.21
28_R	86_V	0.768	0.21
79_I	126_I	0.760	0.21
56_N	61_G	0.737	0.20
44_P	122_G	0.730	0.20
65_E	72_I	0.730	0.20
45_Y	91_A	0.724	0.19
46_R	56_N	0.713	0.19
37_T	120_V	0.711	0.19
100_R	113_G	0.710	0.19
38_A	82_F	0.708	0.19
99_A	110_W	0.700	0.19
73_A	77_S	0.700	0.19
19_H	22_E	0.696	0.19
61_G	109_A	0.695	0.19
26_I	67_R	0.687	0.18
30_N	34_F	0.686	0.18
88_L	125_I	0.686	0.18
46_R	95_V	0.685	0.18
116_V	124_F	0.676	0.18
59_S	63_V	0.670	0.18
84_L	116_V	0.669	0.18
90_A	93_I	0.664	0.18
100_R	124_F	0.663	0.18
21_S	56_N	0.662	0.18
110_W	115_G	0.661	0.18
104_A	107_L	0.656	0.17
109_A	118_S	0.656	0.17
16_Y	20_G	0.651	0.17
83_V	126_I	0.639	0.17
70_G	88_L	0.637	0.17
47_A	56_N	0.633	0.17
17_V	74_L	0.631	0.17
84_L	124_F	0.629	0.17
59_S	123_I	0.624	0.16
19_H	61_G	0.624	0.16
66_G	110_W	0.620	0.16
65_E	79_I	0.614	0.16
29_D	83_V	0.608	0.16
92_G	101_R	0.605	0.16
91_A	124_F	0.604	0.16
88_L	127_P	0.600	0.16
27_T	38_A	0.595	0.16
86_V	97_Y	0.591	0.15
57_D	67_R	0.589	0.15
54_Q	59_S	0.588	0.15
81_L	115_G	0.587	0.15
44_P	125_I	0.586	0.15
40_E	96_G	0.575	0.15
36_E	40_E	0.575	0.15
40_E	108_G	0.575	0.15
51_S	55_D	0.572	0.15
44_P	74_L	0.565	0.15
17_V	20_G	0.564	0.15
84_L	102_R	0.556	0.15
68_G	92_G	0.554	0.15
51_S	60_G	0.553	0.14
42_A	67_R	0.546	0.14
100_R	112_M	0.537	0.14
30_N	33_F	0.536	0.14
32_G	76_L	0.531	0.14
66_G	102_R	0.530	0.14
16_Y	19_H	0.525	0.14
46_R	94_I	0.522	0.14
75_A	106_G	0.522	0.14
77_S	123_I	0.520	0.14
68_G	72_I	0.516	0.14
97_Y	119_L	0.511	0.13
99_A	120_V	0.510	0.13
60_G	107_L	0.507	0.13
74_L	122_G	0.505	0.13
66_G	103_G	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3dh4A	3	0.4574	77.8	0.903	Contact Map
2i68A	2	0.3876	48.5	0.92	Contact Map
4dveA	3	0.5814	36.2	0.926	Contact Map
4tkrA	2	0.5349	33.9	0.927	Contact Map
3wo6A	1	0.4186	25.9	0.931	Contact Map
4pgrA	1	0.5349	23.4	0.933	Contact Map
2rh1A	1	0.4574	21.7	0.933	Contact Map
2xq2A	2	0.5814	19.7	0.935	Contact Map
4ea3A	2	0.9225	19.5	0.935	Contact Map
3rkoL	1	0.3953	18.9	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.