ZUR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ZUR - Zinc-specific metallo-regulatory protein

UniProt:	P54479	Sequences: MNVQEALNLLKENGYKYTNKREDMLQLFADSDRYLTAKNVLSALNDDYPGLSFDTIYRNLSLYEELGILETTELSGEKLFRFKCSFTHHHHHFICLACGKTKEIESCPMDKLCDDLDGYQVSGHKFEIYGTCPDCTAENQENTTA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (130)
Sequences:	6922 (4594)
Seq/√Len:	402.9

ECOLI - FUR ZUR
BACSU - ZUR FUR PERR
SULSO - Q97WH5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
96_L	122_S	4.101	1.00
97_A	131_T	3.770	1.00
100_K	134_D	3.256	1.00
120_Q	136_T	3.153	1.00
28_F	69_L	2.698	1.00
27_L	43_A	2.381	1.00
121_V	128_I	2.289	1.00
118_G	133_P	2.215	1.00
96_L	129_Y	2.152	1.00
17_Y	22_E	2.145	1.00
7_L	22_E	2.092	1.00
64_E	71_T	2.011	1.00
96_L	131_T	1.984	1.00
71_T	80_F	1.914	1.00
42_S	45_N	1.872	1.00
37_A	60_L	1.849	1.00
41_L	53_F	1.834	1.00
64_E	69_L	1.825	1.00
15_Y	66_L	1.773	1.00
61_S	71_T	1.754	1.00
98_C	132_C	1.750	1.00
31_S	43_A	1.742	1.00
8_N	12_E	1.672	1.00
91_H	124_H	1.650	1.00
24_M	59_N	1.648	1.00
93_F	102_K	1.637	1.00
26_Q	30_D	1.601	1.00
122_S	131_T	1.587	1.00
95_C	98_C	1.527	1.00
98_C	135_C	1.519	1.00
41_L	45_N	1.436	1.00
93_F	119_Y	1.409	1.00
23_D	47_D	1.374	1.00
27_L	40_V	1.371	1.00
9_L	13_N	1.371	1.00
25_L	63_Y	1.350	1.00
102_K	119_Y	1.338	1.00
89_H	124_H	1.323	1.00
43_A	46_D	1.318	1.00
34_Y	92_H	1.310	1.00
23_D	26_Q	1.303	1.00
36_T	39_N	1.263	1.00
27_L	44_L	1.254	1.00
22_E	26_Q	1.252	1.00
85_S	88_H	1.248	1.00
132_C	135_C	1.217	1.00
119_Y	133_P	1.215	1.00
34_Y	83_K	1.186	1.00
95_C	132_C	1.170	1.00
20_K	55_T	1.135	1.00
9_L	12_E	1.134	1.00
94_I	129_Y	1.100	1.00
120_Q	131_T	1.082	1.00
131_T	136_T	1.079	1.00
34_Y	90_H	1.062	1.00
27_L	35_L	1.055	1.00
62_L	66_L	1.047	1.00
133_P	137_A	1.047	1.00
35_L	81_R	1.038	1.00
7_L	11_K	1.035	1.00
59_N	62_L	1.017	1.00
119_Y	130_G	1.010	1.00
33_R	43_A	1.001	1.00
41_L	56_I	0.989	1.00
111_K	114_D	0.980	1.00
63_Y	68_I	0.979	1.00
35_L	43_A	0.969	1.00
102_K	117_D	0.967	1.00
38_K	42_S	0.964	1.00
44_L	48_Y	0.964	1.00
25_L	68_I	0.950	1.00
90_H	103_E	0.945	1.00
21_R	62_L	0.941	1.00
15_Y	62_L	0.935	1.00
93_F	130_G	0.934	1.00
93_F	117_D	0.932	1.00
94_I	127_E	0.925	1.00
34_Y	103_E	0.917	1.00
91_H	104_I	0.902	1.00
31_S	35_L	0.891	1.00
37_A	56_I	0.884	1.00
44_L	51_L	0.882	1.00
77_E	81_R	0.880	1.00
20_K	51_L	0.879	1.00
42_S	46_D	0.872	1.00
72_T	103_E	0.872	1.00
35_L	40_V	0.869	1.00
19_N	22_E	0.864	1.00
61_S	64_E	0.855	1.00
94_I	99_G	0.848	1.00
123_G	129_Y	0.837	1.00
118_G	136_T	0.835	1.00
27_L	47_D	0.830	1.00
33_R	39_N	0.826	1.00
95_C	135_C	0.825	1.00
34_Y	101_T	0.822	1.00
21_R	59_N	0.821	1.00
61_S	65_E	0.820	1.00
110_D	113_C	0.806	1.00
28_F	35_L	0.804	1.00
23_D	48_Y	0.802	1.00
45_N	53_F	0.801	1.00
109_M	112_L	0.793	1.00
24_M	40_V	0.779	1.00
106_S	109_M	0.778	1.00
96_L	123_G	0.771	1.00
68_I	84_C	0.759	1.00
26_Q	47_D	0.755	1.00
108_P	111_K	0.751	1.00
38_K	53_F	0.748	1.00
99_G	102_K	0.747	1.00
60_L	64_E	0.744	1.00
124_H	128_I	0.733	1.00
20_K	52_S	0.728	1.00
39_N	42_S	0.726	1.00
113_C	124_H	0.719	1.00
11_K	17_Y	0.717	1.00
19_N	23_D	0.708	1.00
125_K	129_Y	0.705	1.00
134_D	137_A	0.701	1.00
106_S	112_L	0.699	1.00
91_H	107_C	0.698	1.00
107_C	124_H	0.691	1.00
36_T	81_R	0.688	1.00
28_F	36_T	0.685	1.00
91_H	126_F	0.682	1.00
37_A	53_F	0.667	0.99
28_F	40_V	0.663	0.99
29_A	84_C	0.657	0.99
39_N	43_A	0.656	0.99
38_K	41_L	0.649	0.99
27_L	31_S	0.649	0.99
38_K	79_L	0.647	0.99
40_V	56_I	0.643	0.99
24_M	27_L	0.643	0.99
32_D	85_S	0.641	0.99
20_K	59_N	0.640	0.99
92_H	103_E	0.637	0.99
40_V	69_L	0.632	0.99
60_L	69_L	0.632	0.99
10_L	25_L	0.628	0.99
34_Y	52_S	0.628	0.99
91_H	113_C	0.628	0.99
72_T	127_E	0.618	0.99
83_K	90_H	0.615	0.99
94_I	101_T	0.610	0.99
41_L	51_L	0.607	0.99
55_T	59_N	0.606	0.99
89_H	110_D	0.604	0.99
34_Y	38_K	0.595	0.99
93_F	116_L	0.595	0.99
17_Y	25_L	0.595	0.99
106_S	111_K	0.592	0.99
70_E	85_S	0.591	0.99
133_P	136_T	0.591	0.99
30_D	43_A	0.590	0.99
37_A	64_E	0.589	0.99
7_L	17_Y	0.589	0.99
95_C	119_Y	0.585	0.98
25_L	29_A	0.584	0.98
124_H	129_Y	0.583	0.98
77_E	80_F	0.580	0.98
91_H	128_I	0.578	0.98
84_C	87_T	0.573	0.98
15_Y	21_R	0.572	0.98
63_Y	69_L	0.569	0.98
23_D	44_L	0.565	0.98
30_D	47_D	0.561	0.98
10_L	17_Y	0.558	0.98
70_E	125_K	0.558	0.98
115_D	136_T	0.556	0.98
38_K	71_T	0.550	0.98
109_M	113_C	0.547	0.98
37_A	80_F	0.546	0.98
18_T	55_T	0.545	0.98
74_L	77_E	0.540	0.97
18_T	22_E	0.537	0.97
13_N	66_L	0.534	0.97
78_K	82_F	0.532	0.97
55_T	58_R	0.531	0.97
79_L	82_F	0.529	0.97
24_M	63_Y	0.524	0.97
53_F	58_R	0.522	0.97
97_A	100_K	0.521	0.97
107_C	128_I	0.519	0.97
91_H	106_S	0.519	0.97
10_L	62_L	0.517	0.97
102_K	134_D	0.516	0.97
83_K	87_T	0.514	0.97
23_D	27_L	0.513	0.97
92_H	101_T	0.505	0.96
28_F	84_C	0.505	0.96
27_L	30_D	0.504	0.96
8_N	11_K	0.501	0.96
29_A	68_I	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mtdA	2	0.9586	100	0.179	Contact Map
2fe3A	2	0.9448	99.9	0.194	Contact Map
3eyyA	2	0.8966	99.9	0.198	Contact Map
2xigA	4	0.9586	99.9	0.207	Contact Map
4etsA	2	0.9655	99.9	0.227	Contact Map
3mwmA	2	0.8483	99.9	0.231	Contact Map
2w57A	2	0.8759	99.9	0.233	Contact Map
2o03A	2	0.869	99.9	0.251	Contact Map
4lmyA	2	0.9931	99.9	0.255	Contact Map
1mzbA	4	0.8897	99.9	0.296	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.