TRMK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TRMK - tRNA (adenine(22)-N(1))-methyltransferase

UniProt:	P54471	Sequences: MNELKLSKRLQTVAEYIPNGAVMADIGSDHAYLPCYAVLNHKASGAIAGEITDGPFLSAKRQVEKSGLNSHISVRQGDGLEVIKKGEADAITIAGMGGALIAHILEAGKDKLTGKERLILQPNIHAVHIREWLYKERYALIDEVILEEDGKCYEVLVAEAGDRDAAYDGISLSAGMLVGPFLAKEKNAVFLKKWTQELQHTQSIYEQISQAADTEQNKQKLKELADRMELLKEVIDHG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	238 (224)
Sequences:	1301 (1097)
Seq/√Len:	73.3

BACSU - TRMK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
147_E	192_K	5.059	1.00
77_G	82_V	3.915	1.00
28_S	34_P	3.376	1.00
63_V	74_V	3.265	1.00
17_I	37_A	3.175	1.00
202_Q	232_K	3.067	1.00
22_V	45_G	2.899	1.00
133_L	158_A	2.856	1.00
140_L	156_L	2.855	1.00
117_R	159_E	2.674	1.00
28_S	50_E	2.569	1.00
117_R	157_V	2.550	1.00
142_D	185_E	2.459	1.00
175_G	183_A	2.447	1.00
43_A	46_A	2.421	1.00
11_Q	15_E	2.405	1.00
23_M	43_A	2.386	1.00
35_C	62_Q	2.327	1.00
34_P	46_A	2.224	1.00
145_I	189_V	2.114	1.00
132_W	136_E	2.107	1.00
89_D	116_E	2.096	1.00
56_F	74_V	2.091	1.00
64_E	69_N	2.074	1.00
91_I	115_K	2.045	1.00
52_T	55_P	2.041	1.00
23_M	92_T	2.006	1.00
53_D	57_L	1.989	1.00
38_V	43_A	1.987	1.00
38_V	72_I	1.979	1.00
14_A	37_A	1.972	1.00
36_Y	40_N	1.958	1.00
198_L	228_M	1.929	1.00
18_P	117_R	1.924	1.00
144_V	187_N	1.884	1.00
56_F	60_K	1.813	1.00
47_I	75_R	1.794	1.00
75_R	87_E	1.733	1.00
57_L	60_K	1.730	1.00
49_G	82_V	1.728	1.00
103_H	107_A	1.676	1.00
16_Y	144_V	1.638	1.00
131_E	135_K	1.582	0.99
134_Y	176_M	1.572	0.99
80_L	91_I	1.569	0.99
14_A	36_Y	1.560	0.99
60_K	64_E	1.549	0.99
161_G	165_A	1.534	0.99
23_M	37_A	1.532	0.99
201_T	227_R	1.461	0.99
53_D	76_Q	1.443	0.99
58_S	62_Q	1.374	0.98
141_I	159_E	1.371	0.98
222_K	225_A	1.365	0.98
112_L	115_K	1.364	0.98
81_E	107_A	1.358	0.98
50_E	56_F	1.354	0.98
220_K	223_E	1.324	0.98
7_S	148_E	1.288	0.97
12_T	144_V	1.286	0.97
106_E	109_K	1.285	0.97
98_G	122_P	1.275	0.97
38_V	71_H	1.262	0.97
18_P	21_A	1.257	0.97
63_V	72_I	1.257	0.97
31_A	54_G	1.249	0.97
16_Y	157_V	1.235	0.97
205_Y	221_L	1.231	0.97
78_D	81_E	1.230	0.97
19_N	42_K	1.227	0.96
78_D	103_H	1.226	0.96
13_V	94_A	1.214	0.96
147_E	152_C	1.212	0.96
39_L	66_S	1.211	0.96
21_A	44_S	1.204	0.96
142_D	181_F	1.204	0.96
127_V	131_E	1.200	0.96
4_L	39_L	1.194	0.96
12_T	155_V	1.187	0.96
24_A	83_I	1.185	0.96
38_V	46_A	1.182	0.96
6_L	10_L	1.181	0.96
120_L	133_L	1.178	0.96
62_Q	65_K	1.170	0.95
48_A	72_I	1.163	0.95
36_Y	42_K	1.154	0.95
96_M	100_L	1.150	0.95
12_T	15_E	1.143	0.95
102_A	129_I	1.142	0.95
190_F	194_W	1.140	0.95
18_P	157_V	1.119	0.94
180_P	184_K	1.111	0.94
141_I	157_V	1.107	0.94
68_L	72_I	1.105	0.94
120_L	158_A	1.094	0.93
33_L	92_T	1.092	0.93
23_M	46_A	1.084	0.93
106_E	132_W	1.083	0.93
83_I	88_A	1.076	0.93
90_A	117_R	1.075	0.93
109_K	136_E	1.074	0.93
16_Y	142_D	1.066	0.92
51_I	76_Q	1.059	0.92
58_S	61_R	1.045	0.92
22_V	89_D	1.038	0.91
49_G	77_G	1.031	0.91
17_I	92_T	1.026	0.91
205_Y	225_A	1.025	0.91
20_G	44_S	1.020	0.91
229_E	232_K	1.003	0.90
118_L	158_A	0.992	0.89
152_C	189_V	0.987	0.89
201_T	228_M	0.986	0.89
198_L	232_K	0.984	0.89
181_F	184_K	0.981	0.89
105_L	132_W	0.974	0.89
191_L	195_T	0.968	0.88
14_A	33_L	0.967	0.88
32_Y	62_Q	0.962	0.88
52_T	56_F	0.962	0.88
226_D	230_L	0.959	0.88
218_K	221_L	0.947	0.87
34_P	43_A	0.929	0.86
201_T	231_L	0.924	0.86
13_V	155_V	0.923	0.86
26_I	49_G	0.919	0.86
80_L	83_I	0.906	0.85
219_Q	226_D	0.904	0.85
204_I	208_I	0.904	0.85
116_E	138_Y	0.896	0.84
223_E	227_R	0.892	0.84
8_K	11_Q	0.892	0.84
12_T	146_L	0.884	0.83
126_A	193_K	0.878	0.83
49_G	83_I	0.878	0.83
55_P	58_S	0.876	0.83
20_G	90_A	0.868	0.82
34_P	92_T	0.862	0.82
39_L	68_L	0.862	0.82
218_K	222_K	0.856	0.81
145_I	154_E	0.854	0.81
198_L	202_Q	0.853	0.81
45_G	73_S	0.852	0.81
168_D	175_G	0.850	0.81
28_S	49_G	0.850	0.81
154_E	193_K	0.849	0.81
195_T	198_L	0.845	0.80
102_A	128_H	0.844	0.80
221_L	225_A	0.833	0.79
205_Y	228_M	0.831	0.79
201_T	224_L	0.830	0.79
222_K	229_E	0.823	0.79
63_V	68_L	0.822	0.79
39_L	65_K	0.815	0.78
15_E	144_V	0.808	0.77
106_E	136_E	0.806	0.77
26_I	83_I	0.805	0.77
220_K	224_L	0.805	0.77
78_D	107_A	0.800	0.77
214_T	217_N	0.796	0.76
15_E	42_K	0.779	0.75
7_S	152_C	0.774	0.74
130_R	143_E	0.774	0.74
118_L	133_L	0.773	0.74
93_I	104_I	0.772	0.74
60_K	74_V	0.771	0.74
21_A	89_D	0.770	0.74
26_I	80_L	0.769	0.74
37_A	43_A	0.769	0.74
11_Q	40_N	0.764	0.73
6_L	36_Y	0.761	0.73
202_Q	206_E	0.754	0.72
52_T	76_Q	0.752	0.72
139_A	163_R	0.748	0.72
219_Q	222_K	0.748	0.72
151_K	189_V	0.747	0.72
178_V	231_L	0.747	0.72
178_V	183_A	0.746	0.72
75_R	82_V	0.744	0.71
193_K	197_E	0.741	0.71
225_A	229_E	0.739	0.71
28_S	48_A	0.738	0.71
46_A	49_G	0.735	0.70
22_V	88_A	0.734	0.70
35_C	39_L	0.726	0.69
163_R	166_A	0.725	0.69
17_I	90_A	0.721	0.69
47_I	73_S	0.721	0.69
123_N	193_K	0.720	0.69
47_I	88_A	0.719	0.69
206_E	209_S	0.717	0.68
81_E	111_K	0.717	0.68
94_A	121_Q	0.717	0.68
123_N	154_E	0.715	0.68
62_Q	66_S	0.715	0.68
181_F	185_E	0.714	0.68
144_V	185_E	0.713	0.68
91_I	118_L	0.703	0.67
174_A	230_L	0.698	0.66
209_S	225_A	0.695	0.66
174_A	177_L	0.694	0.66
219_Q	223_E	0.691	0.66
198_L	231_L	0.691	0.66
13_V	32_Y	0.682	0.65
217_N	221_L	0.680	0.64
98_G	133_L	0.679	0.64
113_T	160_A	0.677	0.64
161_G	168_D	0.674	0.64
145_I	182_L	0.674	0.64
38_V	63_V	0.673	0.64
35_C	63_V	0.672	0.63
101_I	129_I	0.672	0.63
11_Q	36_Y	0.669	0.63
38_V	42_K	0.665	0.63
78_D	104_I	0.662	0.62
10_L	33_L	0.661	0.62
173_S	226_D	0.661	0.62
35_C	72_I	0.660	0.62
190_F	193_K	0.659	0.62
10_L	34_P	0.654	0.61
154_E	194_W	0.653	0.61
161_G	167_Y	0.652	0.61
131_E	176_M	0.651	0.61
108_G	111_K	0.648	0.61
31_A	34_P	0.648	0.61
77_G	87_E	0.646	0.60
187_N	190_F	0.646	0.60
65_K	150_G	0.643	0.60
105_L	118_L	0.642	0.60
196_Q	200_H	0.637	0.59
202_Q	228_M	0.634	0.59
126_A	129_I	0.631	0.59
50_E	92_T	0.630	0.59
98_G	129_I	0.629	0.58
145_I	190_F	0.628	0.58
215_E	221_L	0.625	0.58
115_K	138_Y	0.623	0.58
55_P	153_Y	0.622	0.58
147_E	150_G	0.620	0.57
45_G	88_A	0.618	0.57
197_E	201_T	0.614	0.57
218_K	225_A	0.614	0.57
121_Q	129_I	0.613	0.56
145_I	152_C	0.613	0.56
63_V	69_N	0.610	0.56
177_L	230_L	0.610	0.56
99_A	128_H	0.609	0.56
152_C	193_K	0.603	0.55
83_I	91_I	0.601	0.55
27_G	79_G	0.600	0.55
27_G	96_M	0.599	0.55
100_L	145_I	0.596	0.54
5_K	93_I	0.595	0.54
75_R	86_G	0.594	0.54
116_E	160_A	0.592	0.54
24_A	91_I	0.592	0.54
77_G	88_A	0.592	0.54
93_I	101_I	0.591	0.54
111_K	123_N	0.591	0.54
90_A	119_I	0.587	0.53
31_A	74_V	0.585	0.53
117_R	141_I	0.584	0.53
22_V	44_S	0.582	0.53
13_V	93_I	0.582	0.53
24_A	88_A	0.581	0.53
215_E	218_K	0.580	0.52
178_V	190_F	0.578	0.52
142_D	219_Q	0.576	0.52
189_V	192_K	0.575	0.52
17_I	119_I	0.574	0.52
100_L	124_I	0.573	0.52
47_I	121_Q	0.572	0.51
73_S	82_V	0.571	0.51
47_I	77_G	0.571	0.51
46_A	54_G	0.570	0.51
6_L	155_V	0.568	0.51
125_H	128_H	0.568	0.51
73_S	77_G	0.568	0.51
204_I	217_N	0.568	0.51
85_K	111_K	0.566	0.51
57_L	61_R	0.564	0.50
18_P	90_A	0.563	0.50
223_E	232_K	0.562	0.50
228_M	232_K	0.562	0.50
13_V	92_T	0.561	0.50
77_G	125_H	0.558	0.50
50_E	101_I	0.558	0.50
81_E	108_G	0.557	0.50
108_G	112_L	0.555	0.49
48_A	55_P	0.555	0.49
100_L	122_P	0.553	0.49
55_P	76_Q	0.551	0.49
224_L	228_M	0.547	0.48
28_S	56_F	0.546	0.48
142_D	157_V	0.546	0.48
121_Q	155_V	0.544	0.48
31_A	49_G	0.544	0.48
51_I	92_T	0.542	0.48
33_L	94_A	0.542	0.48
203_S	206_E	0.541	0.48
126_A	156_L	0.541	0.48
107_A	188_A	0.541	0.48
123_N	194_W	0.540	0.47
56_F	63_V	0.540	0.47
52_T	58_S	0.540	0.47
164_D	226_D	0.539	0.47
125_H	200_H	0.538	0.47
226_D	229_E	0.536	0.47
154_E	178_V	0.536	0.47
17_I	20_G	0.534	0.47
163_R	167_Y	0.533	0.47
131_E	173_S	0.533	0.47
37_A	92_T	0.532	0.46
153_Y	179_G	0.529	0.46
137_R	162_D	0.528	0.46
175_G	179_G	0.528	0.46
201_T	205_Y	0.525	0.46
122_P	149_D	0.522	0.45
140_L	181_F	0.522	0.45
105_L	136_E	0.521	0.45
16_Y	155_V	0.520	0.45
8_K	144_V	0.514	0.44
43_A	71_H	0.514	0.44
91_I	111_K	0.513	0.44
8_K	12_T	0.512	0.44
203_S	207_Q	0.511	0.44
110_D	135_K	0.509	0.44
182_L	190_F	0.509	0.44
119_I	157_V	0.509	0.44
123_N	180_P	0.505	0.43
207_Q	210_Q	0.505	0.43
54_G	100_L	0.504	0.43
134_Y	164_D	0.502	0.43
99_A	125_H	0.501	0.43
177_L	227_R	0.501	0.43
35_C	68_L	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gnlA	1	0.9748	100	0.385	Contact Map
3lecA	2	0.937	100	0.429	Contact Map
3kr9A	1	0.9286	100	0.431	Contact Map
2nxcA	1	0.6345	99.2	0.817	Contact Map
3ocjA	1	0.6681	99.1	0.819	Contact Map
2r3sA	4	0.6513	99	0.826	Contact Map
3evzA	1	0.6597	99	0.828	Contact Map
3k6rA	1	0.6639	99	0.828	Contact Map
4kriA	1	0.8571	99	0.829	Contact Map
2b3tA	1	0.6639	99	0.829	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.