YQEY - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQEY - Uncharacterized protein YqeY

UniProt:	P54464	Sequences: MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSLTEDEELTVLSRELKQRKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	148 (144)
Sequences:	2705 (1838)
Seq/√Len:	153.1

BACSU - YQEY

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_K	89_V	3.294	1.00
10_D	90_Y	3.146	1.00
105_N	146_Q	3.135	1.00
74_L	78_D	2.953	1.00
69_S	81_Q	2.924	1.00
66_Q	70_N	2.593	1.00
97_E	138_L	2.200	1.00
54_L	87_L	2.101	1.00
46_T	49_E	2.040	1.00
101_R	145_S	2.038	1.00
101_R	142_L	1.971	1.00
4_L	37_A	1.921	1.00
11_M	26_V	1.887	1.00
58_L	84_L	1.877	1.00
110_E	129_K	1.863	1.00
29_V	87_L	1.795	1.00
106_E	110_E	1.764	1.00
102_T	106_E	1.733	1.00
106_E	129_K	1.725	1.00
29_V	54_L	1.724	1.00
62_K	88_E	1.720	1.00
85_D	88_E	1.717	1.00
118_D	121_K	1.715	1.00
13_L	17_N	1.685	1.00
78_D	82_K	1.672	1.00
101_R	105_N	1.609	1.00
34_Q	38_I	1.534	1.00
65_L	81_Q	1.523	1.00
103_I	130_V	1.514	1.00
93_E	99_E	1.495	1.00
47_E	50_E	1.476	1.00
73_R	76_L	1.461	1.00
110_E	125_A	1.447	1.00
19_E	22_K	1.444	1.00
134_A	139_I	1.408	1.00
98_E	101_R	1.400	1.00
137_S	141_K	1.389	1.00
9_Q	12_K	1.373	1.00
21_D	82_K	1.373	1.00
81_Q	85_D	1.349	1.00
96_S	99_E	1.346	1.00
33_L	50_E	1.314	1.00
40_L	43_D	1.308	1.00
121_K	124_G	1.303	1.00
6_R	10_D	1.294	1.00
11_M	23_L	1.290	1.00
107_T	111_V	1.289	1.00
65_L	84_L	1.262	1.00
101_R	146_Q	1.255	1.00
119_M	143_V	1.247	1.00
36_E	39_K	1.234	1.00
82_K	85_D	1.228	1.00
35_N	39_K	1.226	1.00
69_S	74_L	1.226	1.00
108_I	146_Q	1.220	1.00
107_T	125_A	1.203	1.00
13_L	16_K	1.198	1.00
9_Q	13_L	1.192	1.00
138_L	141_K	1.190	1.00
116_K	144_S	1.181	1.00
108_I	122_V	1.171	1.00
7_L	26_V	1.162	1.00
43_D	49_E	1.151	1.00
142_L	146_Q	1.148	1.00
124_G	128_P	1.144	1.00
103_I	126_I	1.135	1.00
67_E	71_A	1.117	1.00
21_D	79_K	1.107	0.99
32_S	57_E	1.107	0.99
103_I	106_E	1.098	0.99
97_E	101_R	1.086	0.99
36_E	40_L	1.077	0.99
5_E	9_Q	1.050	0.99
115_S	118_D	1.050	0.99
32_S	35_N	1.049	0.99
113_A	118_D	1.036	0.99
100_L	138_L	1.032	0.99
8_N	30_K	1.025	0.99
125_A	128_P	1.013	0.99
107_T	126_I	0.999	0.99
78_D	81_Q	0.992	0.99
111_V	125_A	0.985	0.99
105_N	109_A	0.979	0.99
102_T	105_N	0.969	0.99
142_L	145_S	0.950	0.98
57_E	60_Q	0.943	0.98
67_E	70_N	0.942	0.98
10_D	13_L	0.941	0.98
69_S	77_V	0.941	0.98
100_L	139_I	0.938	0.98
94_Q	133_K	0.936	0.98
61_R	83_E	0.934	0.98
31_A	35_N	0.933	0.98
63_D	67_E	0.927	0.98
127_M	131_K	0.911	0.98
125_A	129_K	0.906	0.98
9_Q	16_K	0.906	0.98
127_M	136_G	0.895	0.98
24_T	28_M	0.895	0.98
36_E	56_R	0.891	0.98
97_E	141_K	0.888	0.97
93_E	96_S	0.877	0.97
141_K	145_S	0.873	0.97
104_V	146_Q	0.866	0.97
20_K	79_K	0.859	0.97
140_N	144_S	0.855	0.97
23_L	27_R	0.833	0.96
11_M	30_K	0.830	0.96
95_L	103_I	0.823	0.96
58_L	91_L	0.822	0.96
20_K	23_L	0.813	0.96
100_L	134_A	0.807	0.96
103_I	129_K	0.804	0.95
56_R	60_Q	0.801	0.95
77_V	81_Q	0.801	0.95
111_V	122_V	0.798	0.95
126_I	130_V	0.784	0.95
107_T	129_K	0.782	0.95
65_L	80_V	0.782	0.95
65_L	69_S	0.772	0.94
97_E	142_L	0.771	0.94
30_K	34_Q	0.771	0.94
77_V	80_V	0.769	0.94
113_A	122_V	0.769	0.94
126_I	139_I	0.768	0.94
8_N	12_K	0.766	0.94
65_L	77_V	0.766	0.94
127_M	140_N	0.751	0.94
104_V	142_L	0.750	0.93
4_L	33_L	0.739	0.93
5_E	8_N	0.728	0.92
130_V	139_I	0.722	0.92
12_K	15_M	0.713	0.92
21_D	24_T	0.710	0.91
99_E	133_K	0.707	0.91
52_T	55_S	0.704	0.91
6_R	9_Q	0.700	0.91
36_E	45_L	0.697	0.91
52_T	131_K	0.691	0.90
29_V	57_E	0.690	0.90
66_Q	69_S	0.687	0.90
35_N	38_I	0.676	0.89
68_F	80_V	0.675	0.89
39_K	42_K	0.675	0.89
130_V	134_A	0.672	0.89
3_L	50_E	0.671	0.89
36_E	52_T	0.668	0.89
7_L	33_L	0.659	0.88
25_V	82_K	0.658	0.88
100_L	130_V	0.649	0.87
25_V	87_L	0.647	0.87
26_V	30_K	0.645	0.87
103_I	107_T	0.642	0.87
71_A	74_L	0.640	0.87
93_E	133_K	0.640	0.87
45_L	53_V	0.638	0.86
28_M	57_E	0.637	0.86
98_E	102_T	0.635	0.86
38_I	42_K	0.635	0.86
24_T	83_E	0.634	0.86
106_E	109_A	0.633	0.86
37_A	43_D	0.629	0.86
14_Y	26_V	0.628	0.86
45_L	49_E	0.628	0.86
64_S	68_F	0.623	0.85
138_L	142_L	0.622	0.85
40_L	49_E	0.619	0.85
116_K	119_M	0.619	0.85
124_G	127_M	0.614	0.84
8_N	11_M	0.612	0.84
100_L	142_L	0.611	0.84
6_R	89_V	0.611	0.84
36_E	53_V	0.606	0.84
65_L	71_A	0.596	0.83
76_L	80_V	0.594	0.82
31_A	34_Q	0.592	0.82
20_K	24_T	0.592	0.82
11_M	27_R	0.587	0.82
111_V	114_S	0.586	0.81
14_Y	23_L	0.578	0.81
58_L	87_L	0.573	0.80
88_E	93_E	0.571	0.80
4_L	8_N	0.569	0.80
4_L	50_E	0.565	0.79
68_F	71_A	0.564	0.79
119_M	140_N	0.561	0.79
15_M	23_L	0.560	0.79
79_K	83_E	0.556	0.78
76_L	79_K	0.553	0.78
127_M	144_S	0.553	0.78
7_L	30_K	0.550	0.77
21_D	25_V	0.545	0.77
28_M	83_E	0.538	0.76
85_D	89_V	0.535	0.75
114_S	118_D	0.534	0.75
103_I	133_K	0.533	0.75
18_R	23_L	0.533	0.75
67_E	80_V	0.531	0.75
120_G	124_G	0.531	0.75
55_S	131_K	0.528	0.74
68_F	76_L	0.525	0.74
37_A	45_L	0.523	0.74
57_E	83_E	0.522	0.74
130_V	133_K	0.511	0.72
6_R	47_E	0.509	0.72
48_D	51_L	0.509	0.72
11_M	15_M	0.508	0.72
137_S	140_N	0.507	0.71
36_E	43_D	0.507	0.71
61_R	80_V	0.506	0.71
55_S	94_Q	0.503	0.71
64_S	83_E	0.502	0.71
51_L	55_S	0.501	0.71
58_L	62_K	0.501	0.71
111_V	118_D	0.501	0.71
84_L	88_E	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ng6A	1	0.9932	100	0.114	Contact Map
2d6fC	1	0.1959	99.7	0.585	Contact Map
1zq1C	1	0.2162	99.7	0.605	Contact Map
3al0B	1	0.9459	99.3	0.697	Contact Map
3h0lB	1	0.5541	99.2	0.703	Contact Map
3ip4B	1	0.9459	99.2	0.705	Contact Map
2hz7A	1	0	98.5	0.774	Contact Map
4r3zC	1	0	64.4	0.911	Contact Map
4h3sA	1	0	49	0.918	Contact Map
3aiiA	1	0	42.8	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.