YQEK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQEK - Uncharacterized protein YqeK

UniProt:	P54456	Sequences: MNREEALACVKQQLTEHRYIHTVGVMNTAIELAERFGADSKKAEIAAIFHDYAKFRPKEEMKQIIAREKMPAHLLDHNPELWHAPVGAYLVQREAGVQDEDILDAIRYHTSGRPGMTLLEKVIYVADYIEPNRAFPGVDEVRKLAETDLNQALIQSIKNTMVFLMKKNQPVFPDTFLTYNWLVSGS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	186 (179)
Sequences:	1400 (1139)
Seq/√Len:	85.1

BACSU - YQEK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
121_K	150_N	3.612	1.00
42_K	99_D	3.219	1.00
15_T	55_F	3.092	1.00
145_A	152_A	2.858	1.00
42_K	101_D	2.689	1.00
28_T	131_P	2.668	1.00
38_A	118_L	2.647	1.00
91_V	106_I	2.538	1.00
108_Y	120_E	2.469	1.00
26_M	44_E	2.458	1.00
34_E	40_S	2.414	1.00
38_A	122_V	2.407	1.00
22_T	47_A	2.396	1.00
26_M	47_A	2.371	1.00
24_G	132_N	2.297	1.00
29_A	123_I	2.243	1.00
158_K	179_Y	2.230	1.00
104_D	113_R	2.038	1.00
16_E	20_I	2.003	1.00
43_A	119_L	1.969	1.00
113_R	120_E	1.958	1.00
108_Y	113_R	1.868	1.00
165_M	180_N	1.867	1.00
43_A	47_A	1.863	1.00
31_E	146_E	1.838	1.00
53_A	86_V	1.836	1.00
14_L	22_T	1.788	1.00
164_L	171_V	1.778	1.00
45_I	102_I	1.775	1.00
49_F	106_I	1.763	1.00
72_A	82_W	1.736	1.00
30_I	44_E	1.734	1.00
114_P	177_L	1.716	1.00
125_V	152_A	1.712	1.00
176_F	180_N	1.697	1.00
157_I	178_T	1.690	1.00
104_D	120_E	1.663	1.00
73_H	172_F	1.601	1.00
104_D	108_Y	1.594	1.00
9_C	95_A	1.572	1.00
65_I	82_W	1.555	1.00
118_L	149_L	1.545	1.00
144_L	155_Q	1.526	1.00
33_A	43_A	1.488	0.99
24_G	130_E	1.476	0.99
7_L	19_Y	1.434	0.99
92_Q	98_Q	1.420	0.99
6_A	45_I	1.397	0.99
179_Y	183_V	1.346	0.99
61_M	86_V	1.341	0.99
114_P	178_T	1.338	0.99
54_K	80_E	1.323	0.99
63_Q	67_R	1.315	0.99
28_T	129_I	1.303	0.99
135_F	138_V	1.302	0.99
124_Y	153_L	1.294	0.98
125_V	156_S	1.282	0.98
68_E	93_R	1.275	0.98
62_K	66_A	1.255	0.98
141_V	155_Q	1.254	0.98
143_K	147_T	1.250	0.98
64_I	86_V	1.248	0.98
20_I	24_G	1.229	0.98
101_D	120_E	1.218	0.98
30_I	40_S	1.191	0.97
56_R	60_E	1.182	0.97
158_K	168_N	1.179	0.97
115_G	181_W	1.158	0.97
92_Q	100_E	1.143	0.97
49_F	91_V	1.139	0.97
144_L	152_A	1.135	0.96
124_Y	157_I	1.116	0.96
28_T	31_E	1.104	0.96
103_L	107_R	1.093	0.96
138_V	142_R	1.067	0.95
30_I	43_A	1.061	0.95
128_Y	156_S	1.054	0.95
53_A	87_G	1.049	0.94
73_H	76_D	1.043	0.94
11_K	19_Y	1.027	0.94
27_N	131_P	1.023	0.94
88_A	103_L	1.019	0.94
42_K	102_I	1.017	0.94
128_Y	160_T	1.012	0.93
8_A	12_Q	1.011	0.93
117_T	120_E	1.010	0.93
101_D	117_T	1.001	0.93
165_M	176_F	1.001	0.93
180_N	183_V	0.999	0.93
52_Y	87_G	0.998	0.93
140_E	143_K	0.987	0.92
76_D	85_P	0.984	0.92
162_V	166_K	0.975	0.92
84_A	87_G	0.973	0.92
90_L	94_E	0.966	0.92
128_Y	135_F	0.956	0.91
147_T	151_Q	0.952	0.91
100_E	104_D	0.951	0.91
97_V	102_I	0.948	0.91
53_A	61_M	0.941	0.91
88_A	107_R	0.938	0.90
22_T	26_M	0.929	0.90
101_D	104_D	0.925	0.90
10_V	48_I	0.924	0.90
32_L	36_F	0.921	0.90
38_A	119_L	0.916	0.89
35_R	146_E	0.914	0.89
7_L	26_M	0.913	0.89
52_Y	91_V	0.913	0.89
104_D	107_R	0.911	0.89
108_Y	117_T	0.902	0.89
64_I	68_E	0.899	0.88
26_M	30_I	0.898	0.88
137_G	140_E	0.898	0.88
39_D	42_K	0.894	0.88
58_K	79_P	0.889	0.88
9_C	94_E	0.886	0.88
6_A	9_C	0.885	0.88
57_P	60_E	0.882	0.88
125_V	153_L	0.872	0.87
154_I	183_V	0.870	0.87
140_E	155_Q	0.861	0.86
91_V	103_L	0.861	0.86
158_K	162_V	0.855	0.86
30_I	47_A	0.854	0.86
163_F	167_K	0.841	0.85
23_V	26_M	0.836	0.85
118_L	122_V	0.832	0.84
59_E	63_Q	0.827	0.84
121_K	153_L	0.818	0.83
148_D	151_Q	0.817	0.83
125_V	145_A	0.815	0.83
145_A	148_D	0.812	0.83
118_L	121_K	0.811	0.83
154_I	179_Y	0.810	0.83
9_C	13_Q	0.810	0.83
31_E	35_R	0.807	0.82
28_T	146_E	0.805	0.82
133_R	142_R	0.800	0.82
68_E	89_Y	0.796	0.82
27_N	31_E	0.783	0.81
153_L	157_I	0.778	0.80
144_L	151_Q	0.777	0.80
165_M	179_Y	0.776	0.80
158_K	183_V	0.773	0.80
19_Y	23_V	0.770	0.79
5_E	8_A	0.768	0.79
68_E	86_V	0.768	0.79
89_Y	93_R	0.760	0.79
58_K	62_K	0.754	0.78
92_Q	103_L	0.754	0.78
128_Y	141_V	0.750	0.78
30_I	34_E	0.742	0.77
154_I	182_L	0.734	0.76
111_S	172_F	0.732	0.76
31_E	34_E	0.724	0.75
84_A	107_R	0.722	0.75
36_F	149_L	0.719	0.75
87_G	91_V	0.718	0.74
26_M	48_I	0.713	0.74
13_Q	56_R	0.706	0.73
174_D	177_L	0.706	0.73
53_A	90_L	0.703	0.73
6_A	95_A	0.700	0.73
82_W	86_V	0.692	0.72
156_S	159_N	0.690	0.72
158_K	165_M	0.685	0.71
18_R	54_K	0.682	0.71
108_Y	111_S	0.681	0.71
81_L	111_S	0.674	0.70
24_G	27_N	0.667	0.69
104_D	117_T	0.666	0.69
91_V	95_A	0.666	0.69
155_Q	158_K	0.663	0.68
97_V	103_L	0.655	0.68
67_R	93_R	0.654	0.67
176_F	179_Y	0.653	0.67
165_M	183_V	0.653	0.67
55_F	84_A	0.653	0.67
20_I	23_V	0.653	0.67
113_R	117_T	0.652	0.67
46_A	119_L	0.650	0.67
135_F	159_N	0.646	0.67
75_L	170_P	0.635	0.65
78_N	81_L	0.630	0.65
52_Y	65_I	0.629	0.64
24_G	84_A	0.625	0.64
70_M	86_V	0.625	0.64
27_N	34_E	0.623	0.64
36_F	145_A	0.623	0.64
112_G	178_T	0.621	0.63
31_E	36_F	0.617	0.63
14_L	55_F	0.616	0.63
120_E	123_I	0.614	0.63
161_M	176_F	0.614	0.63
89_Y	92_Q	0.611	0.62
10_V	47_A	0.611	0.62
155_Q	159_N	0.608	0.62
85_P	107_R	0.606	0.62
11_K	16_E	0.605	0.61
13_Q	95_A	0.602	0.61
111_S	174_D	0.601	0.61
116_M	120_E	0.599	0.61
116_M	133_R	0.597	0.60
36_F	147_T	0.596	0.60
125_V	129_I	0.595	0.60
20_I	132_N	0.590	0.60
61_M	80_E	0.588	0.59
65_I	79_P	0.585	0.59
108_Y	174_D	0.583	0.59
164_L	169_Q	0.581	0.58
85_P	88_A	0.580	0.58
91_V	97_V	0.577	0.58
45_I	97_V	0.571	0.57
171_V	176_F	0.571	0.57
53_A	56_R	0.568	0.57
63_Q	70_M	0.568	0.57
68_E	72_A	0.567	0.57
46_A	102_I	0.566	0.56
137_G	159_N	0.566	0.56
24_G	131_P	0.562	0.56
29_A	46_A	0.557	0.55
74_L	77_H	0.557	0.55
119_L	123_I	0.555	0.55
62_K	79_P	0.554	0.55
89_Y	107_R	0.552	0.55
157_I	182_L	0.547	0.54
148_D	152_A	0.544	0.53
24_G	28_T	0.544	0.53
56_R	86_V	0.542	0.53
6_A	49_F	0.541	0.53
53_A	91_V	0.539	0.53
63_Q	73_H	0.537	0.53
36_F	152_A	0.537	0.53
60_E	63_Q	0.536	0.52
9_C	87_G	0.536	0.52
25_V	45_I	0.535	0.52
112_G	116_M	0.533	0.52
70_M	85_P	0.531	0.52
76_D	81_L	0.531	0.52
10_V	13_Q	0.527	0.51
49_F	95_A	0.525	0.51
32_L	129_I	0.522	0.51
153_L	182_L	0.522	0.51
23_V	48_I	0.522	0.51
39_D	139_D	0.521	0.50
82_W	110_T	0.518	0.50
9_C	91_V	0.514	0.49
111_S	178_T	0.514	0.49
26_M	95_A	0.513	0.49
57_P	61_M	0.513	0.49
22_T	52_Y	0.512	0.49
6_A	10_V	0.512	0.49
74_L	86_V	0.510	0.49
12_Q	177_L	0.510	0.49
154_I	158_K	0.508	0.49
111_S	157_I	0.508	0.49
128_Y	159_N	0.508	0.49
144_L	147_T	0.508	0.49
54_K	79_P	0.506	0.48
98_Q	103_L	0.505	0.48
24_G	138_V	0.504	0.48
17_H	92_Q	0.503	0.48
66_A	75_L	0.502	0.48
114_P	174_D	0.500	0.48
46_A	105_A	0.500	0.48
89_Y	100_E	0.500	0.48
44_E	47_A	0.500	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ccgA	2	1	100	0.464	Contact Map
2o08A	2	1	100	0.466	Contact Map
2ogiA	2	1	100	0.466	Contact Map
4s1bA	2	0.8978	99.7	0.716	Contact Map
4r8zA	2	0.9194	99.6	0.734	Contact Map
2pq7A	2	0.6452	99.6	0.741	Contact Map
3m1tA	1	0.914	99.5	0.751	Contact Map
3dtoA	2	0.8065	99.5	0.758	Contact Map
4mcwA	2	0.8978	99.5	0.758	Contact Map
3b57A	2	0.8172	99.5	0.759	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.