YQEG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQEG - Uncharacterized protein YqeG

UniProt:	P54452	Sequences: MLKKFFLPDEFVKNIFHITPEKLKERNVKGIITDLDNTLVEWDRPNATPRLIEWFEEMKEHGIKVTIVSNNNERRVKLFSEPLGIPFIYKARKPMGKAFNRAVRNMELKKEDCVVIGDQLLTDVLGGNRNGYHTILVVPVASSDGFITRFNRQVERRILSALKRKGHIQWEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (159)
Sequences:	1287 (996)
Seq/√Len:	78.9

BACSU - YQEG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
127_G	134_T	6.598	1.00
99_F	126_G	3.943	1.00
29_K	112_D	3.432	1.00
9_D	128_N	3.409	1.00
30_G	108_L	3.324	1.00
77_K	81_E	3.052	1.00
108_L	113_C	3.019	1.00
30_G	106_M	2.555	1.00
109_K	112_D	2.449	1.00
28_V	114_V	2.347	1.00
96_G	129_R	2.266	1.00
103_V	113_C	2.214	1.00
56_E	60_E	2.204	1.00
55_F	65_V	2.097	1.00
24_K	29_K	2.091	1.00
35_L	67_I	1.964	1.00
73_E	77_K	1.951	1.00
20_P	58_M	1.882	1.00
12_V	18_I	1.880	1.00
114_V	135_I	1.840	1.00
20_P	63_I	1.766	1.00
6_F	125_L	1.679	1.00
99_F	115_V	1.621	1.00
150_F	154_V	1.620	1.00
19_T	22_K	1.601	1.00
56_E	59_K	1.601	1.00
71_N	76_V	1.594	1.00
13_K	138_V	1.589	1.00
49_P	53_E	1.585	1.00
31_I	114_V	1.538	0.99
67_I	80_S	1.537	0.99
10_E	133_H	1.519	0.99
115_V	132_Y	1.500	0.99
97_K	101_R	1.462	0.99
41_E	44_R	1.461	0.99
124_V	134_T	1.461	0.99
101_R	105_N	1.445	0.99
121_L	154_V	1.434	0.99
31_I	63_I	1.426	0.99
47_A	79_F	1.405	0.99
40_V	79_F	1.375	0.99
64_K	106_M	1.372	0.99
33_T	54_W	1.369	0.99
22_K	26_R	1.350	0.98
9_D	133_H	1.347	0.98
114_V	133_H	1.331	0.98
33_T	65_V	1.330	0.98
30_G	113_C	1.302	0.98
65_V	85_I	1.278	0.98
148_T	151_N	1.272	0.98
102_A	106_M	1.272	0.98
144_D	148_T	1.264	0.98
148_T	152_R	1.249	0.97
145_G	148_T	1.219	0.97
20_P	54_W	1.216	0.97
57_E	60_E	1.162	0.96
21_E	57_E	1.160	0.96
42_W	148_T	1.141	0.96
110_K	131_G	1.135	0.96
96_G	130_N	1.132	0.96
32_I	106_M	1.127	0.95
24_K	61_H	1.125	0.95
15_I	51_L	1.122	0.95
121_L	151_N	1.114	0.95
102_A	126_G	1.089	0.94
125_L	129_R	1.086	0.94
15_I	20_P	1.081	0.94
141_A	144_D	1.057	0.94
32_I	115_V	1.050	0.93
41_E	141_A	1.037	0.93
119_Q	148_T	1.030	0.93
103_V	110_K	1.028	0.93
128_N	134_T	1.012	0.92
23_L	114_V	1.010	0.92
22_K	25_E	1.007	0.92
14_N	17_H	0.998	0.91
57_E	61_H	0.992	0.91
80_S	87_F	0.991	0.91
52_I	56_E	0.984	0.91
66_T	106_M	0.971	0.90
33_T	116_I	0.971	0.90
52_I	82_P	0.970	0.90
16_F	51_L	0.964	0.90
37_N	76_V	0.942	0.89
32_I	68_V	0.933	0.88
12_V	135_I	0.928	0.88
13_K	17_H	0.922	0.88
21_E	25_E	0.920	0.88
153_Q	157_R	0.902	0.87
40_V	47_A	0.898	0.86
71_N	91_A	0.893	0.86
19_T	63_I	0.870	0.85
53_E	57_E	0.867	0.84
73_E	89_Y	0.864	0.84
76_V	80_S	0.864	0.84
88_I	98_A	0.860	0.84
73_E	90_K	0.849	0.83
86_P	105_N	0.846	0.83
103_V	112_D	0.845	0.83
20_P	33_T	0.843	0.83
10_E	135_I	0.843	0.83
127_G	133_H	0.841	0.83
136_L	140_V	0.837	0.82
7_L	162_L	0.835	0.82
38_T	55_F	0.833	0.82
49_P	60_E	0.830	0.82
58_M	61_H	0.827	0.82
49_P	52_I	0.812	0.80
158_I	162_L	0.808	0.80
92_R	97_K	0.807	0.80
144_D	147_I	0.805	0.80
144_D	152_R	0.800	0.79
95_M	129_R	0.799	0.79
119_Q	152_R	0.793	0.79
10_E	22_K	0.792	0.79
100_N	130_N	0.791	0.79
43_D	144_D	0.790	0.78
64_K	86_P	0.790	0.78
18_I	113_C	0.778	0.77
120_L	136_L	0.774	0.77
144_D	151_N	0.770	0.77
75_R	79_F	0.765	0.76
16_F	50_R	0.763	0.76
31_I	58_M	0.761	0.76
29_K	64_K	0.760	0.76
68_V	99_F	0.751	0.75
115_V	126_G	0.750	0.75
35_L	99_F	0.749	0.75
103_V	108_L	0.745	0.74
18_I	135_I	0.743	0.74
160_S	163_K	0.741	0.74
92_R	95_M	0.741	0.74
37_N	152_R	0.728	0.73
151_N	155_E	0.720	0.72
90_K	95_M	0.718	0.72
56_E	61_H	0.717	0.71
68_V	126_G	0.717	0.71
157_R	161_A	0.716	0.71
98_A	127_G	0.705	0.70
25_E	163_K	0.705	0.70
96_G	100_N	0.703	0.70
6_F	158_I	0.696	0.69
10_E	114_V	0.694	0.69
88_I	102_A	0.691	0.69
152_R	155_E	0.687	0.68
153_Q	156_R	0.685	0.68
108_L	112_D	0.682	0.68
121_L	162_L	0.682	0.68
37_N	119_Q	0.679	0.67
110_K	132_Y	0.679	0.67
6_F	121_L	0.677	0.67
151_N	162_L	0.675	0.67
42_W	71_N	0.667	0.66
28_V	133_H	0.667	0.66
66_T	88_I	0.665	0.66
53_E	56_E	0.662	0.65
136_L	139_P	0.662	0.65
109_K	113_C	0.657	0.65
26_R	101_R	0.653	0.64
18_I	116_I	0.651	0.64
72_N	90_K	0.646	0.63
26_R	133_H	0.646	0.63
35_L	75_R	0.645	0.63
68_V	130_N	0.639	0.63
68_V	102_A	0.633	0.62
68_V	91_A	0.633	0.62
35_L	80_S	0.632	0.62
71_N	75_R	0.629	0.61
62_G	119_Q	0.628	0.61
110_K	130_N	0.621	0.60
115_V	130_N	0.620	0.60
59_K	85_I	0.615	0.60
59_K	65_V	0.609	0.59
55_F	59_K	0.608	0.59
42_W	143_S	0.608	0.59
149_R	158_I	0.601	0.58
75_R	137_V	0.599	0.58
66_T	105_N	0.597	0.57
47_A	83_L	0.596	0.57
21_E	59_K	0.591	0.57
24_K	28_V	0.591	0.57
16_F	55_F	0.591	0.57
37_N	148_T	0.589	0.56
35_L	151_N	0.589	0.56
5_F	129_R	0.586	0.56
31_I	135_I	0.586	0.56
44_R	74_R	0.584	0.56
35_L	79_F	0.584	0.56
25_E	107_E	0.584	0.56
81_E	100_N	0.581	0.55
146_F	149_R	0.576	0.55
42_W	145_G	0.574	0.54
72_N	96_G	0.572	0.54
147_I	162_L	0.572	0.54
147_I	150_F	0.568	0.54
67_I	150_F	0.566	0.53
76_V	90_K	0.565	0.53
113_C	161_A	0.564	0.53
11_F	163_K	0.560	0.53
157_R	160_S	0.557	0.52
18_I	129_R	0.555	0.52
73_E	87_F	0.555	0.52
55_F	85_I	0.554	0.52
116_I	135_I	0.554	0.52
144_D	155_E	0.554	0.52
81_E	84_G	0.552	0.52
107_E	113_C	0.552	0.52
52_I	104_R	0.550	0.51
26_R	132_Y	0.550	0.51
41_E	48_T	0.550	0.51
27_N	112_D	0.549	0.51
37_N	144_D	0.549	0.51
47_A	158_I	0.547	0.51
88_I	91_A	0.546	0.51
31_I	61_H	0.546	0.51
98_A	101_R	0.541	0.50
67_I	149_R	0.536	0.50
27_N	47_A	0.534	0.49
78_L	81_E	0.526	0.48
77_K	87_F	0.525	0.48
45_P	78_L	0.523	0.48
62_G	112_D	0.522	0.48
85_I	163_K	0.522	0.48
11_F	138_V	0.521	0.48
29_K	56_E	0.516	0.47
128_N	135_I	0.515	0.47
42_W	149_R	0.513	0.47
28_V	63_I	0.512	0.47
32_I	132_Y	0.512	0.47
24_K	116_I	0.506	0.46
20_P	61_H	0.506	0.46
29_K	74_R	0.505	0.46
5_F	125_L	0.504	0.46
46_N	153_Q	0.503	0.45
76_V	87_F	0.503	0.45
23_L	31_I	0.503	0.45
72_N	92_R	0.502	0.45
43_D	71_N	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3slrA	2	0.9302	99.9	0.564	Contact Map
2hhlA	1	0.907	99.9	0.625	Contact Map
3ib6A	4	0.8023	99.8	0.662	Contact Map
3l8hA	1	0.7965	99.8	0.662	Contact Map
2pr7A	1	0.7442	99.8	0.663	Contact Map
3n1uA	3	0.8953	99.8	0.667	Contact Map
3ij5A	4	0.9535	99.7	0.67	Contact Map
3n07A	3	0.9186	99.7	0.675	Contact Map
2p9jA	5	0.8314	99.7	0.677	Contact Map
2r8eA	5	0.9012	99.7	0.679	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.