PSIE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PSIE - Protein PsiE homolog

UniProt:	P54445	Sequences: MRFSNKFKKVPYLLQALLNVCLFFLALALSALLISETWYIVLFVYKSLFNKVDSYYEMLGELLIFFMYFEFIALIIKYFKSDFHFPLRYFIYIGITAVIRLIIIDHDQAISTFWWAMAILAMICGFFIANRRNSVVEH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (123)
Sequences:	184 (124)
Seq/√Len:	11.2

ECOLI - PSIE
BACSU - PSIE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
117_M	121_A	4.754	1.00
27_L	31_A	2.781	0.92
74_L	126_F	2.402	0.85
60_G	123_I	2.266	0.81
22_L	86_P	2.216	0.79
15_Q	130_N	2.207	0.79
98_V	122_M	2.185	0.78
43_F	59_L	2.121	0.76
79_F	92_Y	2.042	0.73
68_Y	102_I	2.020	0.73
40_I	115_W	1.987	0.71
37_T	74_L	1.959	0.70
74_L	81_S	1.954	0.70
70_E	106_H	1.846	0.65
78_Y	93_I	1.792	0.63
86_P	89_Y	1.766	0.62
68_Y	77_K	1.747	0.61
85_F	103_I	1.727	0.60
11_P	14_L	1.704	0.59
68_Y	89_Y	1.692	0.58
79_F	104_I	1.662	0.57
71_F	119_I	1.634	0.56
104_I	112_T	1.611	0.54
61_E	115_W	1.473	0.48
91_I	99_I	1.456	0.47
78_Y	92_Y	1.452	0.47
56_Y	118_A	1.444	0.46
125_G	131_R	1.425	0.45
82_D	121_A	1.374	0.43
91_I	98_V	1.356	0.42
29_L	103_I	1.356	0.42
88_R	120_L	1.356	0.42
31_A	38_W	1.339	0.41
85_F	102_I	1.333	0.41
68_Y	85_F	1.312	0.40
19_N	79_F	1.310	0.40
20_V	124_C	1.303	0.40
55_Y	63_L	1.261	0.38
38_W	123_I	1.255	0.37
15_Q	18_L	1.240	0.37
37_T	65_F	1.232	0.36
22_L	75_I	1.227	0.36
101_L	115_W	1.214	0.36
98_V	126_F	1.208	0.35
22_L	113_F	1.207	0.35
120_L	124_C	1.199	0.35
32_L	61_E	1.199	0.35
73_A	120_L	1.184	0.34
118_A	126_F	1.178	0.34
54_S	115_W	1.136	0.32
58_M	65_F	1.125	0.32
13_L	27_L	1.111	0.31
21_C	114_W	1.100	0.31
9_K	128_I	1.080	0.30
10_V	31_A	1.079	0.30
107_D	124_C	1.065	0.29
120_L	130_N	1.064	0.29
41_V	63_L	1.059	0.29
53_D	121_A	1.056	0.29
27_L	57_E	1.056	0.29
14_L	26_A	1.044	0.28
79_F	83_F	1.029	0.28
30_S	107_D	1.020	0.28
63_L	82_D	1.020	0.28
13_L	116_A	1.014	0.27
99_I	125_G	1.013	0.27
7_F	116_A	1.006	0.27
79_F	90_F	0.984	0.26
66_F	97_A	0.981	0.26
24_F	113_F	0.977	0.26
98_V	129_A	0.967	0.26
78_Y	85_F	0.964	0.25
85_F	92_Y	0.954	0.25
78_Y	89_Y	0.949	0.25
27_L	42_L	0.947	0.25
62_L	72_I	0.924	0.24
124_C	129_A	0.924	0.24
18_L	112_T	0.923	0.24
19_N	85_F	0.918	0.24
77_K	85_F	0.908	0.23
54_S	122_M	0.906	0.23
74_L	129_A	0.904	0.23
34_I	58_M	0.897	0.23
24_F	53_D	0.892	0.23
74_L	90_F	0.872	0.22
79_F	85_F	0.869	0.22
22_L	89_Y	0.869	0.22
32_L	128_I	0.868	0.22
36_E	64_I	0.867	0.22
65_F	69_F	0.848	0.21
22_L	95_I	0.839	0.21
86_P	96_T	0.838	0.21
45_Y	62_L	0.837	0.21
79_F	102_I	0.827	0.21
113_F	128_I	0.816	0.20
109_A	115_W	0.816	0.20
98_V	118_A	0.811	0.20
16_A	20_V	0.809	0.20
108_Q	113_F	0.807	0.20
30_S	34_I	0.797	0.20
87_L	94_G	0.796	0.20
53_D	57_E	0.789	0.20
90_F	112_T	0.786	0.19
59_L	126_F	0.785	0.19
27_L	110_I	0.782	0.19
35_S	101_L	0.781	0.19
24_F	46_K	0.777	0.19
77_K	86_P	0.773	0.19
56_Y	81_S	0.770	0.19
28_A	37_T	0.770	0.19
57_E	128_I	0.765	0.19
13_L	17_L	0.764	0.19
85_F	89_Y	0.756	0.19
20_V	110_I	0.752	0.18
70_E	97_A	0.751	0.18
77_K	93_I	0.746	0.18
75_I	103_I	0.729	0.18
25_L	34_I	0.721	0.18
14_L	83_F	0.721	0.18
78_Y	86_P	0.715	0.17
91_I	126_F	0.710	0.17
118_A	123_I	0.704	0.17
90_F	106_H	0.703	0.17
25_L	115_W	0.699	0.17
42_L	123_I	0.699	0.17
40_I	61_E	0.697	0.17
18_L	69_F	0.697	0.17
33_L	64_I	0.688	0.17
20_V	54_S	0.676	0.16
76_I	104_I	0.661	0.16
20_V	25_L	0.660	0.16
77_K	83_F	0.660	0.16
11_P	99_I	0.657	0.16
17_L	104_I	0.655	0.16
70_E	77_K	0.654	0.16
76_I	116_A	0.649	0.16
12_Y	20_V	0.648	0.16
83_F	90_F	0.643	0.15
34_I	38_W	0.641	0.15
24_F	41_V	0.635	0.15
68_Y	79_F	0.627	0.15
84_H	100_R	0.626	0.15
68_Y	92_Y	0.624	0.15
16_A	58_M	0.624	0.15
74_L	87_L	0.623	0.15
115_W	122_M	0.619	0.15
32_L	65_F	0.618	0.15
14_L	105_D	0.617	0.15
92_Y	102_I	0.617	0.15
20_V	46_K	0.613	0.15
39_Y	125_G	0.611	0.15
100_R	119_I	0.610	0.15
61_E	98_V	0.604	0.15
69_F	73_A	0.595	0.14
111_S	122_M	0.588	0.14
77_K	92_Y	0.585	0.14
34_I	123_I	0.579	0.14
45_Y	121_A	0.576	0.14
70_E	73_A	0.573	0.14
82_D	128_I	0.573	0.14
17_L	110_I	0.571	0.14
17_L	58_M	0.568	0.14
14_L	106_H	0.561	0.13
25_L	37_T	0.559	0.13
45_Y	131_R	0.557	0.13
40_I	114_W	0.554	0.13
19_N	92_Y	0.553	0.13
30_S	50_N	0.553	0.13
31_A	58_M	0.541	0.13
83_F	92_Y	0.540	0.13
80_K	117_M	0.539	0.13
19_N	93_I	0.539	0.13
30_S	108_Q	0.538	0.13
77_K	90_F	0.537	0.13
74_L	128_I	0.526	0.13
97_A	119_I	0.526	0.13
31_A	80_K	0.525	0.13
45_Y	72_I	0.521	0.13
91_I	129_A	0.519	0.13
43_F	61_E	0.519	0.13
8_K	27_L	0.515	0.12
88_R	127_F	0.512	0.12
8_K	41_V	0.503	0.12
37_T	81_S	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hw9A	3	0.6739	10.2	0.946	Contact Map
5ajiA	3	0.7391	8.2	0.949	Contact Map
1zrtD	1	0.3333	3.4	0.957	Contact Map
3j2wE	1	0.3333	2.4	0.96	Contact Map
3l1lA	2	0.8913	1.7	0.963	Contact Map
1rklA	1	0.2609	1.7	0.963	Contact Map
2mfrA	1	0.2971	1.6	0.964	Contact Map
1qleD	1	0.2609	1.4	0.966	Contact Map
4pn8A	3	0.1667	1.3	0.966	Contact Map
2hacA	2	0.2391	1.3	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.