YPIF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YPIF - Uncharacterized protein YpiF

UniProt:	P54391	Sequences: MRWRITDAKDYLQAKDYIDTAVIPLINIRVNNHFKMAAEKGEFTQLLSEELERQLKGRVYLLPPYTYVDRNEITVQGLKDLREELITEFPHVVLLTSDESWRAEDALGKMIVTSSVPLEHLNDSLKRKILDERTAEILNVLLQLWSTL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	148 (146)
Sequences:	163 (131)
Seq/√Len:	10.8

BACSU - YPIF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
102_R	110_M	3.176	0.96
21_A	62_L	3.038	0.94
93_V	141_L	2.690	0.90
18_I	40_K	2.662	0.89
38_A	41_G	2.568	0.88
38_A	93_V	2.545	0.87
18_I	69_D	2.160	0.76
107_L	110_M	2.038	0.72
21_A	85_L	1.980	0.70
43_F	115_S	1.903	0.66
104_E	110_M	1.871	0.65
53_R	130_L	1.853	0.64
15_K	69_D	1.843	0.64
27_N	40_K	1.767	0.60
92_V	134_T	1.756	0.60
10_D	56_K	1.747	0.59
18_I	129_I	1.741	0.59
11_Y	133_R	1.693	0.57
69_D	113_T	1.684	0.56
11_Y	96_T	1.682	0.56
51_L	111_I	1.664	0.56
93_V	133_R	1.633	0.54
39_E	119_E	1.628	0.54
72_E	78_L	1.606	0.53
81_L	104_E	1.603	0.53
44_T	97_S	1.601	0.53
6_T	11_Y	1.588	0.52
76_Q	129_I	1.573	0.51
35_K	56_K	1.548	0.50
3_W	108_G	1.536	0.49
16_D	116_V	1.457	0.46
25_L	98_D	1.451	0.45
55_L	137_I	1.449	0.45
47_L	130_L	1.447	0.45
3_W	81_L	1.432	0.45
121_L	127_R	1.416	0.44
125_L	142_L	1.401	0.43
26_I	49_E	1.399	0.43
46_L	53_R	1.385	0.42
67_Y	114_S	1.371	0.42
71_N	111_I	1.370	0.42
65_Y	101_W	1.368	0.42
54_Q	117_P	1.368	0.42
47_L	115_S	1.355	0.41
2_R	45_Q	1.354	0.41
77_G	81_L	1.332	0.40
81_L	114_S	1.323	0.39
44_T	135_A	1.313	0.39
17_Y	138_L	1.299	0.38
27_N	98_D	1.286	0.38
48_S	74_T	1.280	0.38
8_A	60_Y	1.274	0.37
54_Q	139_N	1.271	0.37
81_L	133_R	1.268	0.37
125_L	137_I	1.239	0.36
10_D	14_A	1.229	0.35
113_T	140_V	1.221	0.35
134_T	139_N	1.216	0.35
117_P	126_K	1.181	0.33
11_Y	94_L	1.175	0.33
5_I	26_I	1.175	0.33
83_E	106_A	1.162	0.32
66_T	121_L	1.155	0.32
9_K	35_K	1.139	0.31
94_L	132_E	1.137	0.31
82_R	94_L	1.136	0.31
50_E	53_R	1.129	0.31
51_L	113_T	1.126	0.31
92_V	138_L	1.126	0.31
55_L	139_N	1.110	0.30
114_S	133_R	1.106	0.30
18_I	140_V	1.094	0.30
60_Y	70_R	1.085	0.29
21_A	54_Q	1.074	0.29
27_N	112_V	1.071	0.29
14_A	56_K	1.061	0.28
5_I	120_H	1.055	0.28
36_M	82_R	1.043	0.28
44_T	137_I	1.037	0.27
22_V	80_D	1.033	0.27
18_I	68_V	1.029	0.27
87_T	141_L	1.024	0.27
12_L	17_Y	1.017	0.27
59_V	125_L	1.002	0.26
9_K	62_L	0.994	0.26
50_E	131_D	0.956	0.24
102_R	122_N	0.953	0.24
67_Y	133_R	0.952	0.24
18_I	45_Q	0.947	0.24
133_R	136_E	0.943	0.24
98_D	101_W	0.938	0.24
22_V	113_T	0.930	0.24
122_N	128_K	0.924	0.23
6_T	55_L	0.919	0.23
112_V	144_L	0.918	0.23
109_K	123_D	0.916	0.23
90_P	121_L	0.915	0.23
35_K	119_E	0.912	0.23
55_L	119_E	0.912	0.23
25_L	67_Y	0.903	0.23
74_T	121_L	0.902	0.23
27_N	81_L	0.900	0.23
29_R	62_L	0.894	0.22
11_Y	69_D	0.885	0.22
70_R	137_I	0.885	0.22
21_A	89_F	0.872	0.22
29_R	48_S	0.866	0.21
139_N	143_Q	0.855	0.21
79_K	106_A	0.842	0.21
22_V	59_V	0.835	0.20
55_L	135_A	0.834	0.20
28_I	64_P	0.831	0.20
92_V	118_L	0.820	0.20
3_W	16_D	0.811	0.20
9_K	38_A	0.809	0.20
2_R	14_A	0.807	0.20
28_I	144_L	0.807	0.20
75_V	100_S	0.806	0.20
31_N	71_N	0.806	0.20
17_Y	50_E	0.805	0.20
42_E	114_S	0.804	0.20
33_H	127_R	0.799	0.19
21_A	135_A	0.789	0.19
17_Y	38_A	0.780	0.19
41_G	64_P	0.770	0.19
11_Y	77_G	0.769	0.18
40_K	141_L	0.765	0.18
47_L	140_V	0.764	0.18
50_E	128_K	0.764	0.18
28_I	115_S	0.760	0.18
126_K	129_I	0.749	0.18
67_Y	91_H	0.748	0.18
123_D	126_K	0.748	0.18
15_K	118_L	0.747	0.18
32_N	121_L	0.747	0.18
126_K	142_L	0.746	0.18
21_A	126_K	0.743	0.18
29_R	78_L	0.740	0.18
13_Q	37_A	0.734	0.18
112_V	133_R	0.731	0.17
59_V	70_R	0.731	0.17
112_V	136_E	0.727	0.17
51_L	140_V	0.716	0.17
103_A	141_L	0.710	0.17
35_K	62_L	0.709	0.17
31_N	92_V	0.700	0.17
29_R	111_I	0.698	0.17
34_F	68_V	0.696	0.16
21_A	33_H	0.691	0.16
28_I	79_K	0.690	0.16
14_A	18_I	0.684	0.16
76_Q	87_T	0.682	0.16
54_Q	121_L	0.680	0.16
104_E	133_R	0.672	0.16
6_T	60_Y	0.664	0.16
33_H	78_L	0.664	0.16
60_Y	89_F	0.663	0.16
68_V	112_V	0.662	0.16
109_K	121_L	0.659	0.16
33_H	126_K	0.655	0.15
43_F	144_L	0.651	0.15
93_V	115_S	0.647	0.15
65_Y	77_G	0.641	0.15
22_V	95_L	0.638	0.15
4_R	141_L	0.637	0.15
51_L	66_T	0.631	0.15
56_K	129_I	0.629	0.15
33_H	87_T	0.628	0.15
28_I	73_I	0.622	0.15
46_L	124_S	0.621	0.15
9_K	53_R	0.621	0.15
39_E	118_L	0.618	0.15
4_R	13_Q	0.618	0.15
48_S	103_A	0.617	0.15
31_N	45_Q	0.616	0.14
4_R	39_E	0.615	0.14
23_I	78_L	0.615	0.14
47_L	66_T	0.614	0.14
40_K	65_Y	0.614	0.14
35_K	47_L	0.609	0.14
91_H	141_L	0.606	0.14
74_T	139_N	0.600	0.14
22_V	131_D	0.597	0.14
51_L	64_P	0.597	0.14
11_Y	115_S	0.595	0.14
54_Q	74_T	0.590	0.14
89_F	115_S	0.579	0.14
50_E	98_D	0.579	0.14
92_V	102_R	0.573	0.14
3_W	27_N	0.572	0.13
48_S	106_A	0.572	0.13
123_D	141_L	0.569	0.13
17_Y	110_M	0.557	0.13
137_I	146_S	0.556	0.13
43_F	139_N	0.555	0.13
21_A	41_G	0.551	0.13
137_I	142_L	0.551	0.13
51_L	124_S	0.551	0.13
37_A	41_G	0.550	0.13
21_A	117_P	0.550	0.13
4_R	84_E	0.540	0.13
18_I	109_K	0.538	0.13
47_L	64_P	0.536	0.13
119_E	138_L	0.535	0.13
62_L	85_L	0.533	0.13
46_L	140_V	0.529	0.13
84_E	127_R	0.527	0.13
46_L	59_V	0.526	0.12
43_F	65_Y	0.523	0.12
11_Y	67_Y	0.518	0.12
80_D	113_T	0.515	0.12
108_G	129_I	0.513	0.12
55_L	127_R	0.508	0.12
2_R	135_A	0.505	0.12
54_Q	88_E	0.505	0.12
15_K	68_V	0.505	0.12
46_L	116_V	0.502	0.12
6_T	93_V	0.501	0.12
46_L	139_N	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lubA	4	0.7703	47.1	0.941	Contact Map
3no4A	5	0.8176	40.1	0.943	Contact Map
1yyaA	2	0.8446	14.7	0.954	Contact Map
1v7zA	5	0.8243	14.1	0.954	Contact Map
1neyA	2	0.8378	13.2	0.955	Contact Map
4y90A	3	0.8243	12.9	0.955	Contact Map
2j27A	2	0.8514	12	0.956	Contact Map
1o5xA	2	0.7973	11.7	0.956	Contact Map
3krsA	2	0.8311	9.9	0.957	Contact Map
3th6A	2	0.7973	9.6	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.