SODM - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SODM - Superoxide dismutase [Mn]

UniProt:	P54375	Sequences: MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVADLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVARLYSEAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	202 (189)
Sequences:	4187 (2356)
Seq/√Len:	171.3

ECOLI - SODM SODF
BACSU - SODM SODF
HALSA - SODM2 SODM1
SULSO - SODF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_N	37_T	4.075	1.00
177_R	180_D	2.981	1.00
102_A	106_N	2.576	1.00
114_K	117_E	2.556	1.00
22_E	175_Q	2.454	1.00
193_E	196_R	2.453	1.00
123_A	132_A	2.424	1.00
137_N	142_E	2.422	1.00
38_N	41_K	2.302	1.00
21_K	25_T	2.244	1.00
193_E	197_L	2.231	1.00
101_L	195_A	2.203	1.00
163_L	182_I	2.159	1.00
18_H	187_N	2.112	1.00
117_E	121_A	2.089	1.00
103_E	106_N	1.973	1.00
89_L	185_F	1.931	1.00
108_V	140_K	1.910	1.00
126_R	145_S	1.905	1.00
120_A	183_S	1.887	1.00
87_T	193_E	1.882	1.00
104_E	107_S	1.855	1.00
12_Y	29_T	1.846	1.00
114_K	118_Q	1.813	1.00
20_D	173_N	1.804	1.00
180_D	183_S	1.799	1.00
104_E	198_Y	1.771	1.00
161_L	194_V	1.748	1.00
19_I	85_F	1.746	1.00
36_V	79_H	1.725	1.00
123_A	163_L	1.725	1.00
123_A	182_I	1.704	1.00
135_V	144_T	1.663	1.00
121_A	125_G	1.628	1.00
195_A	199_S	1.619	1.00
4_E	7_E	1.606	1.00
39_L	76_G	1.590	1.00
118_Q	121_A	1.577	1.00
104_E	108_V	1.564	1.00
41_K	44_E	1.563	1.00
52_K	60_D	1.552	1.00
37_T	41_K	1.547	1.00
115_F	119_F	1.531	1.00
13_D	21_K	1.516	1.00
100_A	199_S	1.514	1.00
6_P	83_K	1.493	1.00
172_L	175_Q	1.465	1.00
163_L	185_F	1.428	1.00
124_A	179_P	1.417	1.00
79_H	83_K	1.402	1.00
53_S	56_E	1.401	1.00
88_L	194_V	1.390	1.00
90_S	93_G	1.383	1.00
32_H	86_W	1.368	1.00
120_A	124_A	1.365	1.00
174_Y	184_A	1.351	1.00
124_A	182_I	1.347	1.00
135_V	142_E	1.325	1.00
24_M	85_F	1.304	1.00
133_W	146_T	1.302	1.00
43_V	47_T	1.302	1.00
45_G	50_A	1.300	1.00
136_V	198_Y	1.281	1.00
120_A	182_I	1.280	1.00
100_A	103_E	1.278	1.00
22_E	25_T	1.250	1.00
11_A	14_A	1.233	1.00
88_L	193_E	1.230	1.00
38_N	75_N	1.224	1.00
87_T	197_L	1.203	1.00
26_I	175_Q	1.203	1.00
12_Y	25_T	1.181	1.00
120_A	186_W	1.181	1.00
96_E	113_D	1.180	1.00
189_V	194_V	1.171	1.00
25_T	29_T	1.167	1.00
47_T	50_A	1.154	1.00
39_L	72_V	1.153	1.00
142_E	157_K	1.152	1.00
186_W	189_V	1.150	1.00
5_L	28_H	1.140	1.00
132_A	145_S	1.139	1.00
122_A	132_A	1.130	1.00
192_D	195_A	1.127	1.00
12_Y	28_H	1.118	1.00
111_S	114_K	1.117	1.00
160_I	194_V	1.116	1.00
165_V	178_R	1.115	1.00
9_P	87_T	1.107	1.00
77_G	149_Q	1.100	1.00
126_R	132_A	1.098	1.00
119_F	163_L	1.089	1.00
170_Y	178_R	1.087	1.00
112_F	115_F	1.085	1.00
80_A	151_S	1.083	1.00
122_A	143_I	1.076	1.00
83_K	87_T	1.069	1.00
3_Y	43_V	1.063	1.00
85_F	181_Y	1.063	1.00
137_N	157_K	1.062	1.00
96_E	102_A	1.060	1.00
80_A	84_L	1.052	0.99
3_Y	39_L	1.046	0.99
190_N	193_E	1.039	0.99
73_R	150_D	1.034	0.99
117_E	183_S	1.028	0.99
100_A	195_A	1.009	0.99
34_T	38_N	0.998	0.99
31_H	171_Y	0.998	0.99
98_T	195_A	0.983	0.99
88_L	197_L	0.980	0.99
185_F	189_V	0.975	0.99
121_A	124_A	0.972	0.99
103_E	107_S	0.969	0.99
105_I	115_F	0.966	0.99
96_E	106_N	0.964	0.99
115_F	143_I	0.963	0.99
113_D	116_K	0.952	0.99
122_A	145_S	0.951	0.99
84_L	193_E	0.949	0.99
180_D	184_A	0.945	0.99
161_L	189_V	0.937	0.99
184_A	187_N	0.937	0.99
119_F	185_F	0.934	0.99
23_T	173_N	0.921	0.99
12_Y	21_K	0.901	0.98
20_D	23_T	0.901	0.98
61_L	69_R	0.896	0.98
89_L	188_V	0.892	0.98
135_V	157_K	0.888	0.98
48_A	52_K	0.875	0.98
136_V	139_G	0.872	0.98
32_H	83_K	0.867	0.98
36_V	40_N	0.865	0.98
104_E	136_V	0.863	0.98
144_T	157_K	0.857	0.98
105_I	112_F	0.851	0.98
78_G	149_Q	0.846	0.98
54_V	80_A	0.843	0.98
99_G	103_E	0.840	0.97
192_D	196_R	0.840	0.97
90_S	94_G	0.836	0.97
22_E	173_N	0.822	0.97
101_L	198_Y	0.822	0.97
34_T	37_T	0.817	0.97
101_L	194_V	0.815	0.97
30_K	177_R	0.807	0.97
52_K	56_E	0.806	0.97
85_F	163_L	0.799	0.97
112_F	116_K	0.798	0.97
74_N	127_F	0.793	0.96
126_R	147_P	0.791	0.96
90_S	192_D	0.790	0.96
118_Q	122_A	0.786	0.96
80_A	153_L	0.785	0.96
6_P	32_H	0.784	0.96
49_L	52_K	0.784	0.96
101_L	105_I	0.775	0.96
137_N	140_K	0.774	0.96
22_E	26_I	0.765	0.96
29_T	33_N	0.752	0.95
13_D	16_E	0.749	0.95
10_Y	89_L	0.742	0.95
44_E	50_A	0.734	0.95
79_H	86_W	0.732	0.94
92_N	95_G	0.730	0.94
108_V	141_L	0.728	0.94
70_T	73_R	0.726	0.94
96_E	116_K	0.725	0.94
132_A	163_L	0.724	0.94
3_Y	57_L	0.723	0.94
90_S	190_N	0.718	0.94
5_L	32_H	0.711	0.94
136_V	158_T	0.711	0.94
107_S	140_K	0.704	0.93
12_Y	24_M	0.704	0.93
113_D	117_E	0.701	0.93
34_T	124_A	0.697	0.93
82_H	164_D	0.697	0.93
16_E	21_K	0.696	0.93
39_L	54_V	0.691	0.93
136_V	160_I	0.686	0.92
116_K	120_A	0.684	0.92
32_H	79_H	0.680	0.92
58_V	61_L	0.679	0.92
84_L	197_L	0.674	0.92
151_S	154_S	0.671	0.92
97_P	102_A	0.669	0.91
133_W	162_G	0.666	0.91
129_S	148_N	0.666	0.91
116_K	183_S	0.666	0.91
41_K	45_G	0.663	0.91
18_H	184_A	0.658	0.91
30_K	176_N	0.658	0.91
81_N	133_W	0.656	0.91
102_A	112_F	0.655	0.91
19_I	181_Y	0.653	0.90
109_F	118_Q	0.653	0.90
30_K	33_N	0.652	0.90
45_G	48_A	0.641	0.90
106_N	111_S	0.638	0.89
7_E	11_A	0.637	0.89
56_E	60_D	0.637	0.89
27_H	82_H	0.636	0.89
33_N	36_V	0.634	0.89
174_Y	180_D	0.633	0.89
38_N	71_A	0.627	0.89
36_V	83_K	0.626	0.88
130_G	165_V	0.621	0.88
116_K	186_W	0.620	0.88
116_K	187_N	0.620	0.88
24_M	181_Y	0.616	0.88
99_G	102_A	0.611	0.87
77_G	81_N	0.609	0.87
191_W	194_V	0.603	0.87
5_L	33_N	0.603	0.87
61_L	154_S	0.601	0.86
162_G	181_Y	0.596	0.86
35_Y	78_G	0.595	0.86
73_R	149_Q	0.594	0.86
19_I	89_L	0.593	0.86
19_I	24_M	0.592	0.86
144_T	154_S	0.585	0.85
98_T	192_D	0.580	0.84
55_E	80_A	0.580	0.84
149_Q	162_G	0.579	0.84
55_E	59_A	0.578	0.84
49_L	69_R	0.577	0.84
90_S	95_G	0.576	0.84
108_V	142_E	0.575	0.84
18_H	185_F	0.574	0.84
27_H	164_D	0.574	0.84
164_D	168_H	0.567	0.83
125_G	145_S	0.566	0.83
122_A	126_R	0.566	0.83
118_Q	143_I	0.564	0.83
109_F	141_L	0.562	0.83
179_P	183_S	0.562	0.83
73_R	78_G	0.562	0.83
82_H	168_H	0.558	0.82
98_T	102_A	0.557	0.82
126_R	143_I	0.556	0.82
18_H	188_V	0.555	0.82
132_A	165_V	0.554	0.82
39_L	43_V	0.554	0.82
99_G	112_F	0.554	0.82
134_L	141_L	0.551	0.81
9_P	190_N	0.551	0.81
43_V	57_L	0.548	0.81
26_I	172_L	0.546	0.81
5_L	36_V	0.540	0.80
79_H	85_F	0.540	0.80
42_A	72_V	0.536	0.79
69_R	155_E	0.534	0.79
153_L	159_P	0.531	0.79
7_E	29_T	0.530	0.79
27_H	168_H	0.529	0.79
144_T	155_E	0.529	0.79
61_L	73_R	0.524	0.78
3_Y	80_A	0.524	0.78
54_V	61_L	0.523	0.78
31_H	176_N	0.523	0.78
85_F	162_G	0.521	0.78
81_N	149_Q	0.520	0.77
57_L	61_L	0.520	0.77
171_Y	176_N	0.516	0.77
196_R	199_S	0.515	0.77
150_D	155_E	0.511	0.76
47_T	51_N	0.511	0.76
88_L	160_I	0.510	0.76
112_F	186_W	0.509	0.76
26_I	177_R	0.509	0.76
26_I	30_K	0.508	0.76
119_F	143_I	0.506	0.76
123_A	165_V	0.506	0.76
20_D	26_I	0.506	0.76
182_I	186_W	0.505	0.75
98_T	101_L	0.504	0.75
60_D	69_R	0.502	0.75
18_H	173_N	0.502	0.75
3_Y	40_N	0.501	0.75
95_G	98_T	0.500	0.75
22_E	172_L	0.500	0.75
26_I	29_T	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rcvA	2	0.9901	100	-0.021	Contact Map
1gv3A	2	0.995	100	-0.018	Contact Map
1mngA	3	0.9703	100	-0.013	Contact Map
3kkyA	2	0.9802	100	-0.011	Contact Map
3tjtA	2	0.9901	100	-0.01	Contact Map
1xreA	2	0.995	100	-0.007	Contact Map
2cw2A	2	0.9604	100	-0	Contact Map
5a9gA	2	0.9752	100	0.006	Contact Map
3tqjA	2	0.9455	100	0.008	Contact Map
2awpA	2	0.9604	100	0.008	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.