YPJQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YPJQ - Uncharacterized protein YpjQ

UniProt:	P54173	Sequences: MKKYTMNEMVDITKDMLNKRGVMIEDIARIVQKLQEKYNPNLPLSVCMENVEKVLNKREIIHAVLTGLALDQLAEQKLLPEPLQHLVETDEPLYGIDEIIPLSIVNVYGSIGLTNFGYLDKEKIGIIKELDESPDGIHTFLDDIVAALAAAAASRIAHTHQDLQDEEKEQDEKPVVS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	177 (156)
Sequences:	452 (262)
Seq/√Len:	20.9

BACSU - YPJQ YUTG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
81_E	85_H	6.691	1.00
69_A	80_P	4.657	1.00
24_I	48_M	4.307	1.00
77_K	88_E	3.770	1.00
84_Q	88_E	3.684	1.00
25_E	48_M	3.602	1.00
19_K	72_Q	3.334	1.00
10_V	14_K	2.882	0.99
66_T	94_Y	2.670	0.99
119_L	146_A	2.645	0.98
27_I	149_A	2.245	0.96
74_A	79_L	2.241	0.96
130_L	145_V	2.089	0.93
70_L	79_L	2.050	0.93
11_D	15_D	2.006	0.92
38_Y	121_K	1.981	0.91
119_L	127_I	1.964	0.91
87_V	139_T	1.939	0.91
50_N	155_R	1.898	0.90
14_K	52_E	1.878	0.89
49_E	53_K	1.821	0.87
30_I	124_I	1.786	0.86
115_N	147_A	1.775	0.86
99_I	103_S	1.674	0.83
33_K	122_E	1.561	0.78
9_M	96_I	1.549	0.77
33_K	127_I	1.532	0.76
26_D	126_I	1.521	0.76
126_I	129_E	1.481	0.74
10_V	56_N	1.471	0.73
29_R	44_L	1.469	0.73
138_H	141_L	1.432	0.71
13_T	144_I	1.426	0.71
22_V	141_L	1.401	0.70
145_V	149_A	1.363	0.67
116_F	119_L	1.318	0.65
99_I	106_N	1.313	0.64
33_K	116_F	1.307	0.64
68_L	141_L	1.306	0.64
131_D	138_H	1.285	0.63
144_I	154_S	1.281	0.62
7_N	11_D	1.264	0.61
77_K	84_Q	1.228	0.59
106_N	112_G	1.221	0.59
144_I	148_L	1.209	0.58
73_L	79_L	1.200	0.57
127_I	131_D	1.198	0.57
87_V	137_I	1.194	0.57
16_M	19_K	1.184	0.56
69_A	146_A	1.183	0.56
84_Q	138_H	1.172	0.55
29_R	129_E	1.167	0.55
24_I	52_E	1.142	0.53
103_S	126_I	1.139	0.53
27_I	145_V	1.135	0.53
30_I	94_Y	1.132	0.53
32_Q	36_E	1.114	0.52
9_M	12_I	1.110	0.51
8_E	156_I	1.106	0.51
51_V	152_A	1.099	0.51
27_I	51_V	1.083	0.50
133_S	138_H	1.079	0.49
100_I	161_Q	1.071	0.49
16_M	65_L	1.052	0.48
128_K	131_D	1.049	0.47
15_D	19_K	1.048	0.47
31_V	91_E	1.019	0.45
118_Y	122_E	1.014	0.45
70_L	83_L	1.012	0.45
85_H	88_E	1.008	0.45
69_A	72_Q	0.999	0.44
11_D	52_E	0.998	0.44
25_E	44_L	0.992	0.44
92_P	139_T	0.988	0.43
28_A	48_M	0.987	0.43
39_N	50_N	0.968	0.42
79_L	84_Q	0.967	0.42
67_G	121_K	0.952	0.41
16_M	69_A	0.941	0.40
89_T	134_P	0.929	0.40
104_I	107_V	0.929	0.40
96_I	100_I	0.926	0.39
62_H	115_N	0.917	0.39
33_K	119_L	0.911	0.38
107_V	112_G	0.907	0.38
10_V	13_T	0.906	0.38
41_N	72_Q	0.896	0.37
61_I	101_P	0.891	0.37
80_P	84_Q	0.883	0.37
124_I	128_K	0.882	0.37
36_E	40_P	0.881	0.37
12_I	156_I	0.877	0.36
99_I	113_L	0.855	0.35
137_I	161_Q	0.849	0.35
132_E	135_D	0.842	0.34
89_T	161_Q	0.838	0.34
121_K	158_H	0.838	0.34
64_V	68_L	0.835	0.34
11_D	81_E	0.834	0.34
50_N	144_I	0.829	0.33
116_F	146_A	0.821	0.33
10_V	52_E	0.820	0.33
20_R	75_E	0.811	0.32
85_H	89_T	0.811	0.32
27_I	77_K	0.804	0.32
18_N	23_M	0.803	0.32
30_I	119_L	0.786	0.31
144_I	147_A	0.780	0.31
63_A	110_S	0.762	0.30
64_V	103_S	0.758	0.29
44_L	52_E	0.757	0.29
80_P	119_L	0.756	0.29
110_S	115_N	0.749	0.29
30_I	62_H	0.747	0.29
11_D	129_E	0.746	0.29
28_A	51_V	0.745	0.29
104_I	112_G	0.740	0.28
92_P	144_I	0.740	0.28
104_I	115_N	0.729	0.28
81_E	162_D	0.726	0.28
16_M	131_D	0.723	0.27
66_T	99_I	0.717	0.27
24_I	51_V	0.715	0.27
92_P	105_V	0.705	0.27
107_V	116_F	0.704	0.26
27_I	153_A	0.700	0.26
64_V	153_A	0.695	0.26
60_I	104_I	0.693	0.26
112_G	151_A	0.692	0.26
69_A	119_L	0.690	0.26
91_E	130_L	0.689	0.26
103_S	112_G	0.683	0.25
25_E	29_R	0.683	0.25
63_A	93_L	0.680	0.25
112_G	115_N	0.680	0.25
10_V	96_I	0.676	0.25
99_I	115_N	0.676	0.25
29_R	33_K	0.676	0.25
149_A	153_A	0.676	0.25
106_N	118_Y	0.675	0.25
61_I	70_L	0.674	0.25
39_N	115_N	0.673	0.25
17_L	64_V	0.669	0.25
113_L	116_F	0.669	0.25
133_S	136_G	0.668	0.25
45_S	48_M	0.667	0.25
24_I	87_V	0.666	0.25
86_L	92_P	0.664	0.24
83_L	87_V	0.658	0.24
52_E	148_L	0.657	0.24
124_I	147_A	0.651	0.24
16_M	86_L	0.650	0.24
104_I	151_A	0.647	0.24
9_M	155_R	0.644	0.23
66_T	106_N	0.642	0.23
124_I	137_I	0.640	0.23
69_A	116_F	0.637	0.23
9_M	56_N	0.635	0.23
51_V	149_A	0.635	0.23
66_T	131_D	0.634	0.23
66_T	104_I	0.633	0.23
102_L	116_F	0.630	0.23
60_I	64_V	0.630	0.23
107_V	115_N	0.628	0.23
72_Q	76_Q	0.626	0.23
66_T	107_V	0.624	0.23
92_P	132_E	0.624	0.23
16_M	72_Q	0.622	0.22
69_A	73_L	0.620	0.22
39_N	43_P	0.618	0.22
103_S	106_N	0.617	0.22
10_V	65_L	0.615	0.22
19_K	41_N	0.614	0.22
102_L	154_S	0.614	0.22
16_M	122_E	0.609	0.22
9_M	153_A	0.609	0.22
57_K	158_H	0.607	0.22
35_Q	109_G	0.606	0.22
23_M	45_S	0.606	0.22
122_E	146_A	0.604	0.22
29_R	149_A	0.602	0.22
70_L	101_P	0.602	0.22
9_M	159_T	0.599	0.21
61_I	131_D	0.596	0.21
130_L	149_A	0.596	0.21
33_K	124_I	0.594	0.21
94_Y	99_I	0.593	0.21
125_G	137_I	0.592	0.21
12_I	65_L	0.591	0.21
60_I	154_S	0.590	0.21
61_I	75_E	0.589	0.21
26_D	44_L	0.588	0.21
72_Q	80_P	0.586	0.21
86_L	128_K	0.584	0.21
47_C	153_A	0.582	0.21
116_F	127_I	0.579	0.21
8_E	45_S	0.578	0.20
84_Q	87_V	0.575	0.20
41_N	44_L	0.572	0.20
122_E	128_K	0.571	0.20
24_I	40_P	0.566	0.20
147_A	151_A	0.564	0.20
48_M	122_E	0.560	0.20
68_L	138_H	0.560	0.20
87_V	131_D	0.560	0.20
19_K	23_M	0.558	0.20
92_P	156_I	0.553	0.19
65_L	161_Q	0.549	0.19
63_A	139_T	0.547	0.19
15_D	46_V	0.542	0.19
88_E	137_I	0.540	0.19
11_D	32_Q	0.538	0.19
137_I	144_I	0.538	0.19
70_L	159_T	0.538	0.19
34_L	94_Y	0.538	0.19
28_A	44_L	0.538	0.19
132_E	136_G	0.537	0.19
73_L	76_Q	0.534	0.19
13_T	148_L	0.532	0.19
20_R	141_L	0.527	0.18
22_V	136_G	0.524	0.18
65_L	87_V	0.523	0.18
96_I	104_I	0.521	0.18
62_H	68_L	0.518	0.18
110_S	139_T	0.517	0.18
11_D	18_N	0.516	0.18
14_K	96_I	0.516	0.18
30_I	64_V	0.515	0.18
147_A	154_S	0.512	0.18
18_N	46_V	0.509	0.18
106_N	115_N	0.507	0.18
80_P	146_A	0.506	0.18
73_L	153_A	0.504	0.17
127_I	134_P	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1tlqA	4	0.9096	100	0.33	Contact Map
1rfzA	4	0.9096	100	0.379	Contact Map
1y9iA	4	0.8927	100	0.398	Contact Map
2vwaA	1	0.2599	37	0.957	Contact Map
1p3y1	6	0.2542	23.5	0.961	Contact Map
2rreA	1	0.3503	19.1	0.963	Contact Map
3hsqA	3	0.4407	14.5	0.965	Contact Map
4r4eB	2	0.2147	12.9	0.966	Contact Map
3oqpA	2	0.3277	12	0.966	Contact Map
3m6zA	1	0.4294	11	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.