ALKH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ALKH - KHG/KDPG aldolase

UniProt:	P50846	Sequences: MESKVVENRLKEAKLIAVIRSKDKQEACQQIESLLDKGIRAVEVTYTTPGASDIIESFRNREDILIGAGTVISAQQAGEAAKAGAQFIVSPGFSADLAEHLSFVKTHYIPGVLTPSEIMEALTFGFTTLKLFPSGVFGIPFMKNLAGPFPQVTFIPTGGIHPSEVPDWLRAGAGAVGVGSQLGSCSKEDLQAVFQV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	196 (181)
Sequences:	3687 (2506)
Seq/√Len:	186.3

ECOLI - ALKH DGOA
BACSU - ALKH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_R	86_Q	3.794	1.00
95_A	120_E	2.717	1.00
73_S	76_Q	2.612	1.00
33_S	37_K	2.487	1.00
53_D	56_E	2.483	1.00
32_E	61_R	2.463	1.00
94_S	123_T	2.392	1.00
31_I	58_F	2.367	1.00
81_A	106_T	2.309	1.00
52_S	79_E	2.193	1.00
46_Y	52_S	2.082	1.00
28_C	61_R	2.065	1.00
78_G	100_H	2.042	1.00
166_P	170_R	1.944	1.00
56_E	60_N	1.940	1.00
98_A	108_Y	1.926	1.00
121_A	129_L	1.924	1.00
118_I	152_V	1.881	1.00
90_S	108_Y	1.872	1.00
113_L	137_F	1.850	1.00
35_L	64_I	1.846	1.00
99_E	124_F	1.835	1.00
23_D	26_E	1.832	1.00
78_G	82_K	1.831	1.00
122_L	152_V	1.801	1.00
137_F	141_F	1.793	1.00
28_C	57_S	1.785	1.00
32_E	36_D	1.783	1.00
141_F	145_L	1.760	1.00
112_V	118_I	1.753	1.00
71_V	88_I	1.751	1.00
55_I	68_A	1.738	1.00
92_G	119_M	1.726	1.00
75_Q	79_E	1.685	1.00
80_A	85_A	1.672	1.00
114_T	117_E	1.666	1.00
102_S	127_T	1.641	1.00
161_H	164_E	1.633	1.00
88_I	101_L	1.631	1.00
112_V	129_L	1.630	1.00
93_F	98_A	1.622	1.00
100_H	104_V	1.620	1.00
101_L	108_Y	1.612	1.00
76_Q	79_E	1.575	1.00
77_A	88_I	1.573	1.00
67_G	87_F	1.573	1.00
93_F	124_F	1.517	1.00
96_D	123_T	1.505	1.00
24_K	50_G	1.500	1.00
44_V	58_F	1.487	1.00
50_G	53_D	1.452	1.00
131_L	154_F	1.446	1.00
115_P	145_L	1.438	1.00
118_I	149_F	1.417	1.00
122_L	151_Q	1.404	1.00
96_D	99_E	1.373	1.00
142_M	173_A	1.371	1.00
16_I	155_I	1.346	1.00
89_V	109_I	1.330	1.00
135_G	144_N	1.330	1.00
19_I	42_V	1.305	1.00
131_L	137_F	1.294	1.00
95_A	124_F	1.287	1.00
100_H	103_F	1.281	1.00
55_I	66_I	1.263	1.00
136_V	141_F	1.260	1.00
77_A	100_H	1.234	1.00
135_G	140_P	1.221	1.00
77_A	97_L	1.220	1.00
11_K	153_T	1.202	1.00
93_F	112_V	1.197	1.00
35_L	40_R	1.193	1.00
90_S	110_P	1.185	1.00
78_G	104_V	1.182	1.00
53_D	57_S	1.178	1.00
119_M	149_F	1.167	1.00
95_A	99_E	1.159	1.00
31_I	42_V	1.152	1.00
46_Y	80_A	1.142	1.00
57_S	60_N	1.138	1.00
13_A	40_R	1.127	1.00
118_I	145_L	1.123	1.00
135_G	168_W	1.113	1.00
184_S	187_K	1.109	1.00
57_S	61_R	1.099	1.00
68_A	80_A	1.097	1.00
65_L	86_Q	1.095	1.00
99_E	103_F	1.077	1.00
72_I	76_Q	1.070	1.00
134_S	160_I	1.061	1.00
81_A	100_H	1.030	1.00
113_L	141_F	1.028	1.00
136_V	144_N	1.020	1.00
80_A	88_I	1.019	1.00
8_N	11_K	1.016	1.00
79_E	82_K	1.010	0.99
81_A	104_V	1.000	0.99
156_P	173_A	1.000	0.99
165_V	176_V	1.000	0.99
8_N	12_E	0.997	0.99
74_A	100_H	0.994	0.99
167_D	170_R	0.990	0.99
13_A	39_I	0.982	0.99
24_K	54_I	0.963	0.99
116_S	120_E	0.950	0.99
25_Q	57_S	0.949	0.99
94_S	119_M	0.945	0.99
18_V	89_V	0.942	0.99
72_I	151_Q	0.934	0.99
52_S	80_A	0.932	0.99
22_K	185_C	0.930	0.99
88_I	106_T	0.929	0.99
131_L	141_F	0.927	0.99
56_E	82_K	0.926	0.99
28_C	32_E	0.924	0.99
120_E	124_F	0.919	0.99
112_V	121_A	0.917	0.99
155_I	175_A	0.903	0.99
59_R	83_A	0.895	0.99
108_Y	126_F	0.894	0.99
77_A	101_L	0.891	0.99
50_G	54_I	0.890	0.99
21_S	54_I	0.888	0.99
140_P	144_N	0.888	0.99
41_A	65_L	0.884	0.99
75_Q	78_G	0.872	0.99
73_S	123_T	0.868	0.98
93_F	121_A	0.860	0.98
74_A	96_D	0.857	0.98
164_E	167_D	0.856	0.98
98_A	126_F	0.853	0.98
28_C	58_F	0.846	0.98
34_L	183_G	0.818	0.98
15_L	39_I	0.817	0.98
80_A	83_A	0.816	0.98
18_V	157_T	0.812	0.98
93_F	120_E	0.794	0.97
118_I	154_F	0.788	0.97
161_H	181_Q	0.783	0.97
13_A	41_A	0.782	0.97
52_S	83_A	0.781	0.97
24_K	57_S	0.781	0.97
78_G	81_A	0.778	0.97
12_E	40_R	0.777	0.97
29_Q	32_E	0.775	0.97
35_L	63_D	0.757	0.96
156_P	174_G	0.756	0.96
113_L	145_L	0.751	0.96
9_R	12_E	0.744	0.96
142_M	154_F	0.742	0.96
47_T	150_P	0.738	0.96
26_E	29_Q	0.738	0.96
68_A	88_I	0.736	0.96
26_E	188_E	0.733	0.96
92_G	97_L	0.730	0.96
21_S	47_T	0.723	0.95
157_T	177_G	0.723	0.95
54_I	57_S	0.721	0.95
41_A	87_F	0.718	0.95
101_L	106_T	0.710	0.95
146_A	174_G	0.709	0.95
42_V	64_I	0.706	0.95
74_A	78_G	0.705	0.95
48_T	51_A	0.704	0.95
28_C	54_I	0.703	0.95
158_G	179_G	0.694	0.94
12_E	65_L	0.692	0.94
18_V	45_T	0.683	0.94
121_A	124_F	0.682	0.94
46_Y	76_Q	0.682	0.94
98_A	124_F	0.681	0.94
139_I	171_A	0.678	0.93
59_R	66_I	0.676	0.93
88_I	108_Y	0.674	0.93
126_F	129_L	0.669	0.93
109_I	128_T	0.668	0.93
47_T	157_T	0.667	0.93
140_P	167_D	0.666	0.93
161_H	165_V	0.666	0.93
120_E	123_T	0.664	0.93
117_E	149_F	0.663	0.93
9_R	65_L	0.662	0.93
31_I	66_I	0.658	0.92
56_E	59_R	0.655	0.92
39_I	182_L	0.653	0.92
165_V	169_L	0.652	0.92
99_E	123_T	0.652	0.92
10_L	175_A	0.648	0.92
58_F	66_I	0.647	0.92
14_K	169_L	0.647	0.92
144_N	157_T	0.646	0.92
19_I	183_G	0.643	0.92
157_T	178_V	0.638	0.91
15_L	165_V	0.635	0.91
21_S	26_E	0.635	0.91
146_A	154_F	0.628	0.91
27_A	58_F	0.628	0.91
82_K	104_V	0.627	0.91
46_Y	51_A	0.626	0.90
131_L	142_M	0.624	0.90
40_R	63_D	0.617	0.90
128_T	175_A	0.616	0.90
140_P	143_K	0.612	0.89
90_S	101_L	0.607	0.89
94_S	116_S	0.607	0.89
27_A	54_I	0.602	0.89
55_I	83_A	0.600	0.89
163_S	167_D	0.600	0.89
24_K	27_A	0.599	0.88
77_A	106_T	0.594	0.88
143_K	171_A	0.594	0.88
45_T	147_G	0.593	0.88
162_P	165_V	0.591	0.88
29_Q	33_S	0.590	0.88
149_F	152_V	0.588	0.88
56_E	83_A	0.587	0.87
129_L	152_V	0.587	0.87
138_G	141_F	0.586	0.87
30_Q	183_G	0.585	0.87
44_V	51_A	0.584	0.87
52_S	56_E	0.581	0.87
29_Q	34_L	0.580	0.87
139_I	173_A	0.579	0.87
70_T	91_P	0.578	0.87
17_A	39_I	0.577	0.87
134_S	168_W	0.574	0.86
89_V	111_G	0.572	0.86
70_T	130_K	0.571	0.86
184_S	188_E	0.571	0.86
94_S	97_L	0.570	0.86
75_Q	103_F	0.569	0.86
115_P	149_F	0.565	0.85
20_R	185_C	0.565	0.85
147_G	173_A	0.563	0.85
93_F	126_F	0.559	0.85
160_I	164_E	0.558	0.85
21_S	30_Q	0.553	0.84
149_F	177_G	0.551	0.84
44_V	55_I	0.549	0.84
24_K	53_D	0.548	0.84
115_P	141_F	0.548	0.84
118_I	129_L	0.547	0.84
17_A	182_L	0.547	0.84
18_V	47_T	0.545	0.83
20_R	172_G	0.545	0.83
161_H	166_P	0.540	0.83
103_F	123_T	0.536	0.82
94_S	98_A	0.533	0.82
172_G	177_G	0.531	0.82
29_Q	36_D	0.529	0.81
73_S	103_F	0.528	0.81
110_P	126_F	0.527	0.81
90_S	94_S	0.524	0.81
17_A	47_T	0.524	0.81
135_G	143_K	0.523	0.81
113_L	117_E	0.523	0.81
112_V	145_L	0.520	0.80
140_P	163_S	0.518	0.80
44_V	68_A	0.518	0.80
82_K	99_E	0.516	0.80
169_L	176_V	0.513	0.79
45_T	148_P	0.512	0.79
72_I	119_M	0.512	0.79
185_C	188_E	0.509	0.79
32_E	63_D	0.508	0.79
145_L	149_F	0.507	0.79
98_A	102_S	0.505	0.78
79_E	83_A	0.505	0.78
40_R	65_L	0.504	0.78
74_A	97_L	0.502	0.78
77_A	81_A	0.501	0.78
77_A	104_V	0.500	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vhcA	3	1	100	0.459	Contact Map
3vcrA	3	0.9898	100	0.464	Contact Map
1wbhA	3	1	100	0.473	Contact Map
2yw3A	4	0.9796	100	0.478	Contact Map
1mxsA	3	1	100	0.479	Contact Map
4bk9A	3	0.9796	100	0.493	Contact Map
4e38A	3	0.9898	100	0.514	Contact Map
1wa3A	3	0.9847	100	0.541	Contact Map
2v82A	3	0.9643	99.9	0.596	Contact Map
4qccA	6	0.949	99.9	0.605	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.