NRDI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NRDI - Protein NrdI

UniProt:	P50618	Sequences: MVQIIFDSKTGNVQRFVNKTGFQQIRKVDEMDHVDTPFVLVTYTTNFGQVPASTQSFLEKYAHLLLGVAASGNKVWGDNFAKSADTISRQYQVPILHKFELSGTSKDVELFTQEVERVVTKSSAKMDPVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	130 (118)
Sequences:	914 (586)
Seq/√Len:	54.0

ECOLI - NRDI
BACSU - NRDI NRDIB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_K	108_V	4.231	1.00
14_Q	18_N	3.549	1.00
70_A	84_A	3.509	1.00
84_A	95_I	2.614	1.00
17_V	41_V	2.566	1.00
37_P	64_L	2.501	1.00
65_L	91_Y	2.457	1.00
85_D	98_K	2.412	1.00
70_A	95_I	2.254	1.00
4_I	34_V	2.071	1.00
50_V	55_Q	1.982	1.00
65_L	93_V	1.980	1.00
22_F	112_T	1.949	1.00
74_K	80_F	1.943	1.00
69_A	111_F	1.846	0.99
16_F	111_F	1.836	0.99
52_A	55_Q	1.814	0.99
109_E	113_Q	1.792	0.99
50_V	86_T	1.683	0.99
40_L	58_L	1.671	0.99
11_G	102_S	1.669	0.99
51_P	54_T	1.642	0.99
39_V	115_V	1.586	0.98
7_D	54_T	1.580	0.98
60_K	63_H	1.550	0.98
40_L	54_T	1.550	0.98
42_T	87_I	1.524	0.98
70_A	81_A	1.500	0.97
71_S	99_F	1.447	0.97
85_D	95_I	1.437	0.96
79_N	82_K	1.429	0.96
80_F	98_K	1.428	0.96
73_N	100_E	1.426	0.96
49_Q	79_N	1.409	0.96
46_N	79_N	1.408	0.96
82_K	86_T	1.354	0.95
3_Q	41_V	1.277	0.93
73_N	101_L	1.213	0.91
33_H	60_K	1.206	0.91
34_V	57_F	1.206	0.91
97_H	111_F	1.183	0.90
113_Q	117_R	1.173	0.90
11_G	14_Q	1.169	0.90
105_S	109_E	1.165	0.90
96_L	114_E	1.164	0.90
58_L	87_I	1.147	0.89
55_Q	90_Q	1.140	0.89
34_V	61_Y	1.130	0.88
55_Q	86_T	1.130	0.88
110_L	113_Q	1.108	0.87
41_V	69_A	1.104	0.87
70_A	85_D	1.096	0.87
7_D	43_Y	1.090	0.86
116_E	119_V	1.086	0.86
69_A	97_H	1.067	0.85
5_I	34_V	1.066	0.85
43_Y	76_W	1.061	0.85
60_K	92_Q	1.030	0.83
11_G	18_N	1.010	0.82
27_K	31_M	1.009	0.82
15_R	102_S	0.996	0.81
12_N	101_L	0.984	0.80
27_K	30_E	0.980	0.80
13_V	43_Y	0.968	0.79
49_Q	86_T	0.951	0.78
47_F	76_W	0.942	0.77
68_V	87_I	0.914	0.75
9_K	45_T	0.909	0.74
54_T	70_A	0.904	0.74
69_A	99_F	0.904	0.74
75_V	101_L	0.896	0.73
114_E	118_V	0.890	0.73
81_A	98_K	0.888	0.73
55_Q	59_E	0.884	0.72
37_P	66_L	0.880	0.72
44_T	68_V	0.863	0.70
13_V	71_S	0.853	0.70
51_P	77_G	0.852	0.69
97_H	110_L	0.851	0.69
45_T	76_W	0.844	0.69
75_V	100_E	0.840	0.68
39_V	67_G	0.838	0.68
16_F	45_T	0.828	0.67
13_V	45_T	0.813	0.66
89_R	92_Q	0.811	0.66
65_L	98_K	0.805	0.65
16_F	99_F	0.796	0.64
63_H	105_S	0.791	0.64
58_L	62_A	0.787	0.63
40_L	87_I	0.786	0.63
113_Q	116_E	0.783	0.63
39_V	96_L	0.776	0.62
7_D	45_T	0.776	0.62
71_S	96_L	0.772	0.62
78_D	81_A	0.751	0.60
116_E	120_T	0.744	0.59
22_F	96_L	0.743	0.59
7_D	53_S	0.743	0.59
10_T	36_T	0.740	0.59
33_H	116_E	0.725	0.57
27_K	56_S	0.715	0.56
20_T	110_L	0.712	0.56
73_N	76_W	0.707	0.55
28_V	32_D	0.705	0.55
21_G	24_Q	0.690	0.53
5_I	90_Q	0.687	0.53
14_Q	26_R	0.683	0.53
33_H	36_T	0.681	0.52
12_N	44_T	0.680	0.52
48_G	101_L	0.673	0.51
16_F	107_D	0.669	0.51
59_E	90_Q	0.664	0.50
59_E	84_A	0.662	0.50
81_A	96_L	0.660	0.50
42_T	120_T	0.656	0.50
42_T	49_Q	0.654	0.49
70_A	102_S	0.651	0.49
25_I	28_V	0.650	0.49
64_L	112_T	0.646	0.49
39_V	118_V	0.641	0.48
38_F	65_L	0.638	0.48
4_I	36_T	0.638	0.48
3_Q	24_Q	0.636	0.48
31_M	117_R	0.632	0.47
58_L	93_V	0.630	0.47
19_K	44_T	0.629	0.47
18_N	21_G	0.612	0.45
23_Q	29_D	0.608	0.45
47_F	66_L	0.606	0.44
99_F	118_V	0.606	0.44
63_H	117_R	0.603	0.44
31_M	56_S	0.603	0.44
63_H	66_L	0.599	0.44
46_N	102_S	0.599	0.44
70_A	88_S	0.598	0.43
6_F	19_K	0.597	0.43
37_P	114_E	0.596	0.43
39_V	66_L	0.590	0.43
12_N	48_G	0.589	0.43
47_F	84_A	0.588	0.42
4_I	41_V	0.586	0.42
24_Q	78_D	0.584	0.42
73_N	99_F	0.583	0.42
45_T	97_H	0.583	0.42
74_K	102_S	0.574	0.41
22_F	36_T	0.573	0.41
80_F	85_D	0.569	0.40
46_N	51_P	0.568	0.40
77_G	83_S	0.566	0.40
52_A	86_T	0.564	0.40
9_K	42_T	0.563	0.40
71_S	81_A	0.560	0.40
53_S	90_Q	0.555	0.39
38_F	93_V	0.546	0.38
62_A	83_S	0.545	0.38
51_P	83_S	0.538	0.37
11_G	52_A	0.536	0.37
59_E	91_Y	0.536	0.37
50_V	59_E	0.536	0.37
67_G	107_D	0.536	0.37
66_L	118_V	0.528	0.36
38_F	104_T	0.522	0.36
117_R	120_T	0.520	0.36
49_Q	71_S	0.520	0.36
62_A	91_Y	0.515	0.35
40_L	77_G	0.514	0.35
8_S	71_S	0.513	0.35
38_F	62_A	0.512	0.35
12_N	46_N	0.511	0.35
37_P	91_Y	0.507	0.34
22_F	116_E	0.505	0.34
54_T	77_G	0.505	0.34
85_D	89_R	0.503	0.34
66_L	109_E	0.503	0.34
91_Y	98_K	0.502	0.34
28_V	36_T	0.501	0.34
84_A	98_K	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rljA	1	0.9692	99.9	0.541	Contact Map
3n3aC	1	0.9308	99.9	0.558	Contact Map
2xodA	1	0.9077	99.8	0.623	Contact Map
4n82B	1	0.9462	99.7	0.66	Contact Map
1bvyF	1	0.9769	99.4	0.722	Contact Map
3hr4A	2	0.9923	99.4	0.728	Contact Map
2bpoA	1	0.9923	99.4	0.73	Contact Map
2bmvA	1	0.9385	99.4	0.731	Contact Map
3qe2A	1	0.9769	99.3	0.741	Contact Map
1yobA	1	0.9692	99.3	0.743	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.