SP3AF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP3AF - Stage III sporulation protein AF

UniProt:	P49783	Sequences: MSFLTEWLTTIVLFILFAIVIDMLLPSSSMQKYAKMVVSLLLIVVMLTPIFKLFKTDPEVIFEYLTKNGQSESADIKNQINSKKIEIQASQRAYILEEMAVQLKKKAEERFSHDEYKVGRIKLTAGEKVDSEEDIKTISVYMAPSSEKTVQTVAPVHIDTDHAYVTKEAAEQKEAKQIQTQLADIWEIGSEKITVHMEGGESVGNE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	206 (191)
Sequences:	334 (305)
Seq/√Len:	22.1

BACSU - SP3AF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_W	11_I	3.585	1.00
137_T	194_T	3.053	1.00
140_V	182_L	3.011	1.00
8_L	43_I	2.902	0.99
14_F	45_V	2.881	0.99
104_K	123_L	2.869	0.99
59_E	156_V	2.451	0.98
99_M	186_W	2.427	0.98
21_I	106_K	2.363	0.97
123_L	135_I	2.225	0.96
84_K	94_Y	2.212	0.96
7_W	49_P	2.056	0.94
27_S	31_Q	2.043	0.94
132_E	151_Q	2.005	0.93
12_V	186_W	1.929	0.91
84_K	87_I	1.925	0.91
15_I	195_V	1.923	0.91
22_D	45_V	1.921	0.91
138_I	188_I	1.920	0.91
118_V	135_I	1.903	0.91
25_L	34_A	1.872	0.90
100_A	186_W	1.867	0.90
25_L	123_L	1.694	0.85
18_A	42_L	1.675	0.84
36_M	99_M	1.663	0.84
15_I	47_L	1.641	0.83
42_L	186_W	1.616	0.82
159_D	162_H	1.604	0.82
14_F	84_K	1.576	0.80
4_L	182_L	1.547	0.79
117_K	182_L	1.539	0.79
6_E	54_F	1.539	0.79
24_L	57_D	1.533	0.78
22_D	51_F	1.497	0.77
50_I	135_I	1.492	0.76
155_P	195_V	1.491	0.76
179_Q	193_I	1.489	0.76
43_I	187_E	1.470	0.75
83_K	86_E	1.467	0.75
17_F	48_T	1.445	0.74
135_I	188_I	1.433	0.73
172_Q	175_A	1.427	0.73
165_V	168_E	1.425	0.73
37_V	40_L	1.418	0.73
34_A	39_S	1.414	0.72
46_M	111_F	1.405	0.72
155_P	190_S	1.384	0.71
51_F	56_T	1.378	0.70
42_L	107_A	1.375	0.70
25_L	138_I	1.371	0.70
8_L	142_M	1.369	0.70
43_I	46_M	1.345	0.69
41_L	96_L	1.336	0.68
21_I	33_Y	1.332	0.68
23_M	40_L	1.324	0.67
58_P	103_L	1.323	0.67
78_N	89_A	1.307	0.66
10_T	39_S	1.296	0.66
4_L	150_V	1.292	0.65
111_F	178_I	1.291	0.65
8_L	39_S	1.283	0.65
87_I	95_I	1.274	0.64
120_R	139_S	1.271	0.64
122_K	195_V	1.270	0.64
111_F	118_V	1.254	0.63
110_R	185_I	1.253	0.63
51_F	178_I	1.251	0.63
12_V	107_A	1.249	0.63
32_K	44_V	1.244	0.62
18_A	186_W	1.242	0.62
17_F	174_E	1.234	0.62
33_Y	182_L	1.234	0.62
79_Q	156_V	1.230	0.61
92_R	107_A	1.219	0.61
50_I	157_H	1.204	0.60
122_K	164_Y	1.198	0.59
93_A	96_L	1.197	0.59
23_M	60_V	1.188	0.59
84_K	93_A	1.186	0.59
190_S	193_I	1.156	0.57
151_Q	154_A	1.149	0.56
39_S	107_A	1.139	0.55
20_V	38_V	1.133	0.55
157_H	191_E	1.129	0.55
162_H	192_K	1.124	0.54
160_T	163_A	1.111	0.54
22_D	37_V	1.101	0.53
93_A	97_E	1.098	0.53
54_F	142_M	1.097	0.53
97_E	138_I	1.089	0.52
7_W	51_F	1.088	0.52
34_A	38_V	1.079	0.51
16_L	65_L	1.051	0.49
67_K	173_K	1.049	0.49
94_Y	104_K	1.047	0.49
7_W	111_F	1.042	0.49
18_A	37_V	1.039	0.49
143_A	189_G	1.039	0.49
188_I	192_K	1.038	0.49
39_S	46_M	1.034	0.48
87_I	93_A	1.033	0.48
20_V	84_K	1.022	0.47
4_L	8_L	1.009	0.47
107_A	186_W	1.008	0.47
27_S	47_L	1.002	0.46
9_T	20_V	0.993	0.46
162_H	165_V	0.987	0.45
11_I	54_F	0.980	0.45
3_F	7_W	0.973	0.44
148_K	156_V	0.963	0.43
176_K	193_I	0.963	0.43
43_I	58_P	0.962	0.43
33_Y	41_L	0.960	0.43
14_F	22_D	0.959	0.43
17_F	188_I	0.958	0.43
5_T	9_T	0.956	0.43
29_S	117_K	0.953	0.43
43_I	51_F	0.948	0.42
102_Q	186_W	0.943	0.42
47_L	60_V	0.943	0.42
138_I	152_T	0.938	0.42
87_I	111_F	0.922	0.41
35_K	38_V	0.908	0.40
148_K	151_Q	0.907	0.40
15_I	113_H	0.904	0.40
99_M	133_E	0.899	0.39
128_K	188_I	0.892	0.39
10_T	36_M	0.889	0.39
95_I	98_E	0.883	0.38
35_K	129_V	0.882	0.38
97_E	101_V	0.881	0.38
15_I	27_S	0.875	0.38
10_T	25_L	0.872	0.38
49_P	102_Q	0.864	0.37
20_V	36_M	0.862	0.37
99_M	107_A	0.861	0.37
38_V	127_E	0.860	0.37
14_F	51_F	0.859	0.37
161_D	178_I	0.858	0.37
136_K	151_Q	0.856	0.37
111_F	116_Y	0.853	0.36
10_T	52_K	0.851	0.36
11_I	190_S	0.844	0.36
40_L	50_I	0.840	0.35
28_S	40_L	0.839	0.35
20_V	133_E	0.836	0.35
124_T	184_D	0.829	0.35
20_V	32_K	0.824	0.35
20_V	88_Q	0.818	0.34
157_H	195_V	0.817	0.34
153_V	160_T	0.814	0.34
124_T	129_V	0.804	0.33
105_K	156_V	0.803	0.33
6_E	10_T	0.801	0.33
110_R	181_Q	0.801	0.33
8_L	99_M	0.801	0.33
39_S	57_D	0.800	0.33
6_E	9_T	0.797	0.33
125_A	176_K	0.788	0.32
10_T	24_L	0.783	0.32
19_I	187_E	0.782	0.32
1_M	8_L	0.778	0.32
168_E	172_Q	0.774	0.31
60_V	156_V	0.770	0.31
180_T	184_D	0.768	0.31
188_I	196_H	0.767	0.31
15_I	45_V	0.767	0.31
14_F	21_I	0.767	0.31
86_E	93_A	0.763	0.31
51_F	132_E	0.759	0.31
14_F	106_K	0.759	0.31
162_H	191_E	0.756	0.30
142_M	197_M	0.750	0.30
142_M	193_I	0.749	0.30
30_M	156_V	0.747	0.30
52_K	99_M	0.744	0.30
44_V	187_E	0.744	0.30
164_Y	195_V	0.734	0.29
143_A	162_H	0.729	0.29
8_L	149_T	0.728	0.29
16_L	140_V	0.724	0.29
140_V	178_I	0.722	0.29
8_L	81_N	0.718	0.28
87_I	94_Y	0.717	0.28
31_Q	102_Q	0.717	0.28
1_M	87_I	0.712	0.28
77_K	125_A	0.711	0.28
17_F	92_R	0.709	0.28
89_A	100_A	0.707	0.28
124_T	137_T	0.702	0.27
21_I	153_V	0.698	0.27
39_S	112_S	0.696	0.27
41_L	54_F	0.693	0.27
18_A	152_T	0.692	0.27
42_L	113_H	0.685	0.27
128_K	189_G	0.681	0.26
56_T	128_K	0.679	0.26
116_Y	174_E	0.675	0.26
147_E	188_I	0.675	0.26
2_S	195_V	0.673	0.26
7_W	95_I	0.673	0.26
67_K	151_Q	0.669	0.26
147_E	184_D	0.668	0.26
86_E	94_Y	0.666	0.26
16_L	133_E	0.662	0.25
162_H	168_E	0.662	0.25
58_P	61_I	0.658	0.25
7_W	84_K	0.656	0.25
28_S	38_V	0.656	0.25
10_T	42_L	0.656	0.25
133_E	136_K	0.655	0.25
23_M	185_I	0.655	0.25
98_E	102_Q	0.654	0.25
60_V	120_R	0.651	0.25
42_L	190_S	0.649	0.25
52_K	180_T	0.649	0.25
142_M	174_E	0.647	0.25
60_V	176_K	0.646	0.24
77_K	153_V	0.642	0.24
31_Q	36_M	0.641	0.24
140_V	192_K	0.638	0.24
2_S	177_Q	0.634	0.24
138_I	186_W	0.633	0.24
42_L	84_K	0.631	0.24
99_M	132_E	0.630	0.24
78_N	159_D	0.630	0.24
147_E	150_V	0.628	0.24
24_L	88_Q	0.624	0.23
42_L	101_V	0.622	0.23
40_L	140_V	0.621	0.23
4_L	120_R	0.618	0.23
108_E	147_E	0.617	0.23
4_L	122_K	0.614	0.23
157_H	165_V	0.612	0.23
43_I	53_L	0.608	0.23
85_I	88_Q	0.607	0.23
141_Y	196_H	0.604	0.22
179_Q	184_D	0.603	0.22
131_S	188_I	0.602	0.22
88_Q	168_E	0.599	0.22
18_A	27_S	0.596	0.22
40_L	186_W	0.596	0.22
16_L	57_D	0.595	0.22
101_V	162_H	0.588	0.22
103_L	178_I	0.586	0.22
14_F	44_V	0.582	0.21
117_K	138_I	0.579	0.21
43_I	61_I	0.578	0.21
3_F	53_L	0.576	0.21
61_I	64_Y	0.574	0.21
129_V	144_P	0.572	0.21
23_M	37_V	0.572	0.21
122_K	139_S	0.570	0.21
52_K	157_H	0.564	0.21
16_L	186_W	0.559	0.20
67_K	148_K	0.558	0.20
49_P	193_I	0.554	0.20
81_N	171_E	0.554	0.20
7_W	102_Q	0.554	0.20
119_G	153_V	0.551	0.20
47_L	53_L	0.549	0.20
51_F	181_Q	0.544	0.20
156_V	162_H	0.541	0.20
16_L	132_E	0.532	0.19
14_F	98_E	0.532	0.19
80_I	140_V	0.530	0.19
36_M	125_A	0.527	0.19
167_K	177_Q	0.527	0.19
33_Y	114_D	0.526	0.19
30_M	40_L	0.525	0.19
37_V	150_V	0.524	0.19
53_L	136_K	0.522	0.19
6_E	122_K	0.521	0.19
65_L	73_S	0.517	0.19
74_A	193_I	0.515	0.18
93_A	156_V	0.514	0.18
15_I	188_I	0.514	0.18
107_A	111_F	0.513	0.18
57_D	100_A	0.511	0.18
44_V	95_I	0.510	0.18
78_N	100_A	0.509	0.18
27_S	36_M	0.509	0.18
59_E	133_E	0.505	0.18
25_L	103_L	0.503	0.18
35_K	78_N	0.501	0.18
29_S	183_A	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1gyxA	2	0.2524	16.4	0.944	Contact Map
3mb2B	3	0.2573	13.9	0.946	Contact Map
3m20A	5	0.2427	12.3	0.947	Contact Map
3m21A	4	0.2621	12.1	0.947	Contact Map
2opaA	4	0.2476	11.9	0.947	Contact Map
2eelA	1	0.2961	11.6	0.947	Contact Map
3ry0A	4	0.2476	11.6	0.947	Contact Map
4x1cC	5	0.2476	11.4	0.948	Contact Map
2dzmA	1	0.301	11.4	0.948	Contact Map
4u5rA	3	0.2524	11	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.