SP3AD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP3AD - Stage III sporulation protein AD

UniProt:	P49781	Sequences: MQIDIVQIVGLGLIATFLSLIVKEQKPTFAFLIVVFAGCAIFLYLVDQIYDIIRMIEKIAINANVNMVYVETILKIIGIAYIAEFGAQLTKDAGQGAIASKIELAGKILILVMAVPILTVIIETILGLIPSMS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	133 (127)
Sequences:	472 (375)
Seq/√Len:	33.3

BACSU - SP3AD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_A	37_A	6.730	1.00
12_G	102_I	5.275	1.00
83_A	106_G	3.409	1.00
87_A	91_K	2.420	0.99
4_D	48_Q	2.294	0.99
20_L	125_I	2.136	0.99
74_L	78_G	2.081	0.98
45_L	104_L	2.024	0.98
23_K	27_P	1.997	0.98
42_F	83_A	1.886	0.97
96_G	100_S	1.870	0.97
90_T	122_I	1.862	0.97
46_V	82_I	1.854	0.97
84_E	88_Q	1.813	0.96
71_E	90_T	1.800	0.96
8_I	41_I	1.754	0.95
111_L	115_V	1.517	0.90
38_G	101_K	1.516	0.90
38_G	97_A	1.502	0.90
26_K	121_I	1.501	0.90
84_E	117_I	1.495	0.90
107_K	110_I	1.459	0.88
95_Q	105_A	1.441	0.88
28_T	90_T	1.439	0.88
9_V	82_I	1.433	0.87
42_F	88_Q	1.423	0.87
121_I	124_T	1.410	0.87
33_I	117_I	1.409	0.87
72_T	110_I	1.404	0.86
86_G	102_I	1.401	0.86
68_V	72_T	1.390	0.86
91_K	103_E	1.386	0.86
6_V	14_I	1.379	0.85
10_G	91_K	1.376	0.85
33_I	128_L	1.361	0.85
105_A	128_L	1.337	0.84
91_K	96_G	1.270	0.80
120_V	124_T	1.250	0.79
23_K	59_I	1.211	0.77
72_T	82_I	1.203	0.76
35_V	57_E	1.185	0.75
19_S	97_A	1.180	0.75
9_V	86_G	1.152	0.73
77_I	81_Y	1.132	0.72
81_Y	85_F	1.125	0.71
91_K	125_I	1.124	0.71
39_C	43_L	1.124	0.71
20_L	23_K	1.121	0.71
35_V	109_L	1.112	0.70
34_V	97_A	1.106	0.70
109_L	113_M	1.103	0.70
5_I	9_V	1.103	0.70
31_F	86_G	1.099	0.70
9_V	109_L	1.096	0.69
73_I	77_I	1.094	0.69
59_I	100_S	1.078	0.68
115_V	119_T	1.065	0.67
29_F	118_L	1.061	0.67
97_A	127_G	1.060	0.67
65_V	86_G	1.050	0.66
76_I	110_I	1.034	0.65
14_I	17_F	1.026	0.64
76_I	117_I	1.014	0.63
26_K	125_I	1.012	0.63
13_L	45_L	1.006	0.63
18_L	27_P	0.995	0.62
62_N	91_K	0.979	0.60
7_Q	82_I	0.975	0.60
16_T	56_I	0.971	0.60
93_A	103_E	0.970	0.60
59_I	98_I	0.961	0.59
20_L	24_E	0.936	0.57
56_I	78_G	0.936	0.57
68_V	106_G	0.917	0.55
41_I	125_I	0.915	0.55
53_I	60_A	0.889	0.53
52_I	112_V	0.887	0.53
8_I	86_G	0.886	0.53
89_L	117_I	0.886	0.53
78_G	84_E	0.876	0.52
71_E	122_I	0.865	0.51
8_I	46_V	0.864	0.51
65_V	89_L	0.859	0.51
22_V	33_I	0.858	0.51
79_I	109_L	0.854	0.50
55_M	115_V	0.853	0.50
31_F	129_I	0.847	0.50
18_L	43_L	0.842	0.49
109_L	126_L	0.838	0.49
111_L	121_I	0.831	0.48
61_I	74_L	0.827	0.48
60_A	80_A	0.823	0.48
62_N	121_I	0.821	0.47
11_L	49_I	0.819	0.47
8_I	42_F	0.813	0.47
49_I	58_K	0.808	0.46
34_V	44_Y	0.807	0.46
119_T	123_E	0.800	0.46
8_I	111_L	0.797	0.45
20_L	45_L	0.796	0.45
56_I	121_I	0.791	0.45
45_L	70_V	0.786	0.45
88_Q	100_S	0.785	0.44
44_Y	57_E	0.782	0.44
45_L	120_V	0.777	0.44
15_A	19_S	0.776	0.44
38_G	110_I	0.775	0.44
55_M	119_T	0.771	0.43
80_A	89_L	0.765	0.43
81_Y	117_I	0.759	0.42
31_F	35_V	0.758	0.42
26_K	89_L	0.757	0.42
5_I	66_N	0.755	0.42
104_L	111_L	0.754	0.42
12_G	98_I	0.753	0.42
50_Y	57_E	0.746	0.41
4_D	109_L	0.744	0.41
7_Q	125_I	0.732	0.40
101_K	107_K	0.732	0.40
50_Y	76_I	0.729	0.40
4_D	112_V	0.721	0.39
22_V	25_Q	0.720	0.39
36_F	112_V	0.717	0.39
14_I	112_V	0.711	0.38
66_N	113_M	0.710	0.38
28_T	125_I	0.705	0.38
10_G	95_Q	0.700	0.38
28_T	122_I	0.698	0.37
35_V	61_I	0.692	0.37
38_G	114_A	0.687	0.37
28_T	121_I	0.686	0.36
58_K	127_G	0.685	0.36
22_V	27_P	0.681	0.36
22_V	30_A	0.677	0.36
35_V	54_R	0.675	0.36
14_I	46_V	0.674	0.36
80_A	95_Q	0.673	0.35
91_K	97_A	0.669	0.35
76_I	114_A	0.666	0.35
49_I	110_I	0.662	0.35
10_G	24_E	0.660	0.34
100_S	103_E	0.659	0.34
14_I	98_I	0.656	0.34
29_F	67_M	0.655	0.34
14_I	106_G	0.644	0.33
106_G	122_I	0.635	0.33
10_G	105_A	0.634	0.33
18_L	32_L	0.632	0.32
44_Y	122_I	0.627	0.32
23_K	103_E	0.612	0.31
71_E	99_A	0.612	0.31
51_D	83_A	0.611	0.31
16_T	99_A	0.611	0.31
54_R	58_K	0.609	0.31
8_I	58_K	0.607	0.31
8_I	85_F	0.599	0.30
42_F	99_A	0.597	0.30
63_A	76_I	0.593	0.30
73_I	108_I	0.589	0.29
34_V	98_I	0.585	0.29
42_F	87_A	0.585	0.29
69_Y	107_K	0.585	0.29
58_K	70_V	0.578	0.29
90_T	96_G	0.574	0.28
93_A	102_I	0.560	0.27
38_G	82_I	0.550	0.27
28_T	54_R	0.549	0.27
47_D	67_M	0.547	0.26
46_V	95_Q	0.546	0.26
10_G	97_A	0.546	0.26
17_F	129_I	0.543	0.26
7_Q	80_A	0.542	0.26
84_E	122_I	0.541	0.26
104_L	113_M	0.540	0.26
52_I	118_L	0.536	0.26
22_V	56_I	0.521	0.25
105_A	114_A	0.521	0.25
19_S	96_G	0.520	0.25
12_G	90_T	0.513	0.24
102_I	106_G	0.511	0.24
24_E	95_Q	0.508	0.24
53_I	73_I	0.508	0.24
5_I	41_I	0.508	0.24
19_S	118_L	0.506	0.24
24_E	123_E	0.506	0.24
77_I	82_I	0.504	0.24
34_V	74_L	0.503	0.24
11_L	14_I	0.500	0.24
12_G	129_I	0.500	0.24
30_A	72_T	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mt1A	3	0.8722	4.1	0.949	Contact Map
3w9iA	3	0.8722	3.4	0.951	Contact Map
3ne5A	3	0.8722	3.3	0.951	Contact Map
4k0jA	3	0.797	3.2	0.951	Contact Map
4dx5A	3	0.8496	3.2	0.951	Contact Map
4bemA	3	0.5188	2.9	0.952	Contact Map
4v1gA	3	0.5338	2.3	0.955	Contact Map
3zk1A	5	0.5414	2.1	0.956	Contact Map
2ekfA	1	0.2105	2.1	0.956	Contact Map
1a91A	1	0.5038	1.7	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.