YQHV - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQHV - Uncharacterized protein YqhV

UniProt:	P49779	Sequences: MKFLLGNINSTVLTMAGLRVLSSMIELTAAIVMLVTNDVRKAVVVNSILAIVGPLIFIITMTVGIYQIAGQLSYAKLILIFTGVVLILAGVHK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	93 (86)
Sequences:	155 (121)
Seq/√Len:	13.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_L	86_L	3.645	0.99
12_V	33_M	3.062	0.97
80_I	90_G	2.987	0.97
29_A	45_V	2.870	0.96
85_V	89_A	2.841	0.95
32_V	45_V	2.354	0.88
31_I	34_L	1.938	0.76
60_T	63_V	1.897	0.74
68_I	75_A	1.804	0.70
44_V	88_L	1.752	0.68
55_L	59_I	1.741	0.67
16_A	39_V	1.735	0.67
35_V	71_Q	1.694	0.65
82_T	86_L	1.667	0.64
9_N	69_A	1.657	0.63
10_S	67_Q	1.652	0.63
25_I	32_V	1.651	0.63
20_V	27_L	1.572	0.59
23_S	27_L	1.559	0.58
40_R	71_Q	1.547	0.58
36_T	45_V	1.547	0.58
75_A	81_F	1.545	0.58
28_T	33_M	1.528	0.57
18_L	23_S	1.479	0.54
11_T	14_T	1.471	0.54
44_V	47_S	1.388	0.49
44_V	63_V	1.263	0.43
66_Y	71_Q	1.206	0.40
21_L	82_T	1.200	0.40
41_K	63_V	1.185	0.39
15_M	34_L	1.170	0.38
27_L	76_K	1.162	0.38
61_M	67_Q	1.157	0.38
40_R	67_Q	1.141	0.37
87_I	92_H	1.139	0.37
20_V	59_I	1.136	0.37
9_N	40_R	1.124	0.36
15_M	64_G	1.117	0.36
11_T	88_L	1.098	0.35
52_V	86_L	1.039	0.32
10_S	61_M	1.022	0.31
41_K	60_T	1.008	0.31
27_L	63_V	1.007	0.31
51_I	61_M	1.006	0.30
25_I	82_T	0.999	0.30
35_V	40_R	0.998	0.30
51_I	79_L	0.967	0.29
9_N	35_V	0.965	0.29
47_S	60_T	0.959	0.28
25_I	55_L	0.958	0.28
78_I	84_V	0.952	0.28
29_A	77_L	0.931	0.27
12_V	16_A	0.921	0.27
29_A	33_M	0.910	0.26
48_I	80_I	0.909	0.26
9_N	38_D	0.909	0.26
12_V	36_T	0.905	0.26
9_N	14_T	0.893	0.26
17_G	24_M	0.888	0.25
61_M	77_L	0.881	0.25
37_N	41_K	0.878	0.25
47_S	79_L	0.862	0.24
43_V	57_F	0.843	0.24
14_T	77_L	0.826	0.23
14_T	45_V	0.810	0.23
36_T	82_T	0.790	0.22
29_A	65_I	0.779	0.21
74_Y	77_L	0.778	0.21
20_V	23_S	0.774	0.21
36_T	55_L	0.773	0.21
8_I	37_N	0.759	0.21
23_S	57_F	0.751	0.20
69_A	75_A	0.738	0.20
32_V	48_I	0.722	0.19
33_M	87_I	0.720	0.19
57_F	67_Q	0.713	0.19
8_I	13_L	0.706	0.19
7_N	84_V	0.704	0.19
42_A	49_L	0.698	0.19
31_I	81_F	0.693	0.19
40_R	51_I	0.663	0.18
67_Q	71_Q	0.654	0.17
39_V	80_I	0.653	0.17
62_T	74_Y	0.651	0.17
32_V	36_T	0.642	0.17
18_L	47_S	0.636	0.17
62_T	88_L	0.636	0.17
10_S	35_V	0.634	0.17
9_N	65_I	0.633	0.17
25_I	45_V	0.627	0.17
40_R	92_H	0.624	0.16
20_V	24_M	0.624	0.16
13_L	37_N	0.622	0.16
41_K	88_L	0.621	0.16
8_I	34_L	0.613	0.16
16_A	34_L	0.609	0.16
15_M	43_V	0.607	0.16
18_L	61_M	0.592	0.16
23_S	63_V	0.584	0.15
57_F	61_M	0.583	0.15
55_L	66_Y	0.578	0.15
9_N	92_H	0.578	0.15
59_I	69_A	0.573	0.15
23_S	41_K	0.570	0.15
31_I	55_L	0.569	0.15
13_L	87_I	0.566	0.15
45_V	57_F	0.565	0.15
20_V	68_I	0.564	0.15
27_L	31_I	0.552	0.14
44_V	60_T	0.551	0.14
36_T	66_Y	0.550	0.14
58_I	74_Y	0.549	0.14
45_V	75_A	0.534	0.14
64_G	76_K	0.527	0.14
45_V	92_H	0.521	0.14
62_T	81_F	0.521	0.14
57_F	60_T	0.517	0.14
41_K	72_L	0.516	0.14
32_V	68_I	0.513	0.13
64_G	90_G	0.511	0.13
21_L	68_I	0.510	0.13
58_I	86_L	0.508	0.13
82_T	89_A	0.508	0.13
78_I	90_G	0.507	0.13
58_I	88_L	0.503	0.13
12_V	72_L	0.502	0.13
59_I	84_V	0.502	0.13
30_A	37_N	0.502	0.13
24_M	47_S	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4i0uA	4	0.9355	7	0.936	Contact Map
4ev6A	3	0.9355	6.4	0.937	Contact Map
1wazA	1	0.4409	3.5	0.944	Contact Map
2lzrA	1	0.2581	2.9	0.947	Contact Map
1wglA	1	0.4731	2.4	0.949	Contact Map
1p3qQ	2	0.3871	2.4	0.949	Contact Map
2dhyA	1	0.4624	2.3	0.949	Contact Map
2qksA	4	0.9462	1.7	0.953	Contact Map
2i68A	2	0.6989	1.2	0.957	Contact Map
3fmgA	3	0.1828	1.1	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.