EFP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

EFP - Elongation factor P

UniProt:	P49778	Sequences: MISVNDFRTGLTIEVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVAKAQIETKTMQYLYANGDQHVFMDTSSYEQLELSATQIEEELKYLLENMSVHIMMYQDETLGIELPNTVELKVVETEPGIKGDTASGGTKPAKTETGLVVNVPFFVNEGDTLVVNTSDGSYVSRA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	185 (182)
Sequences:	2782 (1314)
Seq/√Len:	97.4

ECOLI - EFPL EFP
BACSU - EFP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
132_K	171_T	3.745	1.00
69_T	110_S	2.917	1.00
68_K	84_D	2.744	1.00
18_G	43_N	2.574	1.00
28_V	36_F	2.503	1.00
136_T	152_A	2.476	1.00
153_K	159_V	2.473	1.00
104_Y	179_G	2.456	1.00
73_L	90_Q	2.402	1.00
45_R	119_E	2.387	1.00
132_K	155_E	2.334	1.00
167_N	170_D	2.319	1.00
160_V	172_L	2.310	1.00
130_E	171_T	2.249	1.00
173_V	183_S	2.235	1.00
103_K	158_L	2.171	1.00
14_E	61_A	2.156	1.00
133_V	172_L	2.126	1.00
134_V	153_K	2.072	1.00
135_E	168_E	1.981	1.00
4_V	57_G	1.950	1.00
130_E	173_V	1.933	1.00
81_V	92_E	1.910	1.00
152_A	162_V	1.898	1.00
131_L	154_T	1.870	1.00
132_K	168_E	1.847	1.00
79_Q	92_E	1.838	1.00
69_T	112_H	1.764	1.00
71_Q	85_T	1.762	1.00
132_K	169_G	1.734	1.00
106_L	155_E	1.714	1.00
71_Q	110_S	1.703	1.00
16_D	52_K	1.703	1.00
70_M	113_I	1.677	1.00
135_E	153_K	1.671	1.00
15_V	52_K	1.657	1.00
85_T	110_S	1.636	1.00
75_A	95_A	1.624	1.00
113_I	120_T	1.616	1.00
72_Y	75_A	1.558	1.00
133_V	166_V	1.537	1.00
14_E	117_Q	1.507	1.00
28_V	32_K	1.502	1.00
7_F	22_V	1.499	1.00
75_A	78_D	1.495	1.00
70_M	91_L	1.468	1.00
55_R	58_E	1.451	1.00
134_V	154_T	1.447	1.00
165_F	181_Y	1.432	1.00
148_G	164_F	1.380	0.99
104_Y	158_L	1.377	0.99
76_N	79_Q	1.368	0.99
128_T	182_V	1.351	0.99
94_S	97_Q	1.343	0.99
141_K	144_T	1.328	0.99
131_L	155_E	1.318	0.99
76_N	92_E	1.300	0.99
43_N	46_T	1.293	0.99
13_I	60_V	1.274	0.99
7_F	60_V	1.261	0.99
30_P	33_G	1.259	0.99
39_S	54_F	1.247	0.99
83_M	90_Q	1.245	0.99
74_Y	81_V	1.245	0.99
30_P	36_F	1.245	0.99
13_I	41_L	1.239	0.99
106_L	109_M	1.232	0.99
95_A	102_L	1.228	0.99
127_N	177_S	1.214	0.99
80_H	102_L	1.203	0.98
166_V	170_D	1.188	0.98
32_K	36_F	1.188	0.98
128_T	173_V	1.155	0.98
139_G	164_F	1.154	0.98
154_T	174_V	1.150	0.98
154_T	172_L	1.139	0.98
131_L	156_T	1.137	0.98
103_K	179_G	1.122	0.97
9_T	24_D	1.112	0.97
82_F	98_I	1.076	0.97
14_E	116_Y	1.070	0.97
15_V	54_F	1.059	0.96
133_V	152_A	1.056	0.96
20_W	50_Q	1.054	0.96
134_V	155_E	1.052	0.96
133_V	168_E	1.050	0.96
79_Q	94_S	1.049	0.96
75_A	80_H	1.048	0.96
19_I	116_Y	1.046	0.96
4_V	56_A	1.035	0.96
18_G	45_R	1.021	0.96
12_T	19_I	1.007	0.95
25_F	37_V	1.007	0.95
128_T	175_N	1.000	0.95
4_V	22_V	0.996	0.95
38_R	53_T	0.994	0.95
106_L	171_T	0.985	0.95
173_V	182_V	0.983	0.95
23_V	42_R	0.979	0.95
165_F	170_D	0.977	0.94
136_T	151_P	0.973	0.94
82_F	123_I	0.968	0.94
19_I	63_A	0.960	0.94
154_T	158_L	0.959	0.94
160_V	174_V	0.955	0.94
115_M	120_T	0.953	0.94
67_T	124_E	0.932	0.93
40_K	51_E	0.931	0.93
175_N	178_D	0.931	0.93
71_Q	108_N	0.924	0.93
27_H	37_V	0.896	0.91
149_T	161_N	0.892	0.91
75_A	81_V	0.890	0.91
143_D	164_F	0.889	0.91
78_D	95_A	0.877	0.91
99_E	102_L	0.871	0.90
68_K	115_M	0.869	0.90
9_T	25_F	0.858	0.90
19_I	64_Q	0.858	0.90
80_H	95_A	0.857	0.90
28_V	38_R	0.847	0.89
43_N	48_A	0.846	0.89
12_T	67_T	0.842	0.89
12_T	63_A	0.839	0.89
5_N	22_V	0.836	0.88
4_V	7_F	0.835	0.88
143_D	148_G	0.832	0.88
93_L	97_Q	0.829	0.88
7_F	11_L	0.826	0.88
140_I	143_D	0.816	0.87
80_H	98_I	0.813	0.87
37_V	56_A	0.811	0.87
14_E	63_A	0.809	0.87
19_I	44_L	0.802	0.86
98_I	123_I	0.801	0.86
19_I	45_R	0.798	0.86
136_T	140_I	0.796	0.86
14_E	17_G	0.796	0.86
97_Q	119_E	0.795	0.86
34_A	51_E	0.794	0.86
105_L	109_M	0.788	0.85
154_T	159_V	0.786	0.85
163_P	181_Y	0.784	0.85
149_T	159_V	0.784	0.85
93_L	120_T	0.775	0.84
91_L	115_M	0.775	0.84
151_P	161_N	0.770	0.84
7_F	39_S	0.763	0.83
141_K	145_A	0.758	0.83
135_E	159_V	0.756	0.83
76_N	81_V	0.755	0.83
70_M	111_V	0.754	0.83
140_I	164_F	0.754	0.83
75_A	102_L	0.754	0.83
20_W	41_L	0.751	0.82
31_G	35_A	0.750	0.82
67_T	114_M	0.744	0.82
136_T	168_E	0.740	0.81
139_G	152_A	0.737	0.81
66_E	118_D	0.736	0.81
29_K	32_K	0.734	0.81
101_E	122_G	0.732	0.81
84_D	87_S	0.730	0.81
38_R	51_E	0.726	0.80
82_F	93_L	0.726	0.80
63_A	116_Y	0.720	0.80
170_D	184_R	0.719	0.80
13_I	22_V	0.717	0.79
115_M	118_D	0.709	0.79
134_V	156_T	0.703	0.78
25_F	39_S	0.691	0.77
11_L	22_V	0.691	0.77
5_N	9_T	0.688	0.76
33_G	53_T	0.686	0.76
24_D	40_K	0.684	0.76
78_D	93_L	0.676	0.75
32_K	35_A	0.674	0.75
28_V	35_A	0.672	0.75
136_T	162_V	0.671	0.75
33_G	38_R	0.667	0.74
31_G	36_F	0.663	0.74
3_S	6_D	0.660	0.73
98_I	101_E	0.655	0.73
44_L	114_M	0.654	0.73
29_K	53_T	0.646	0.72
137_E	151_P	0.645	0.72
71_Q	90_Q	0.642	0.71
175_N	182_V	0.640	0.71
85_T	88_Y	0.640	0.71
14_E	19_I	0.639	0.71
11_L	62_K	0.639	0.71
151_P	159_V	0.634	0.70
5_N	37_V	0.627	0.70
82_F	111_V	0.617	0.68
28_V	33_G	0.616	0.68
4_V	60_V	0.615	0.68
72_Y	81_V	0.615	0.68
40_K	49_I	0.614	0.68
67_T	112_H	0.611	0.68
19_I	121_L	0.609	0.67
72_Y	102_L	0.607	0.67
27_H	31_G	0.607	0.67
82_F	113_I	0.606	0.67
129_V	176_T	0.605	0.67
112_H	124_E	0.601	0.66
78_D	94_S	0.597	0.66
4_V	58_E	0.596	0.66
33_G	36_F	0.596	0.66
13_I	52_K	0.594	0.65
18_G	46_T	0.594	0.65
106_L	131_L	0.593	0.65
65_I	114_M	0.593	0.65
52_K	60_V	0.593	0.65
148_G	151_P	0.592	0.65
165_F	184_R	0.590	0.65
84_D	91_L	0.589	0.65
138_P	152_A	0.589	0.65
109_M	126_P	0.588	0.65
139_G	148_G	0.588	0.65
29_K	33_G	0.586	0.64
22_V	25_F	0.585	0.64
138_P	145_A	0.584	0.64
7_F	57_G	0.580	0.64
64_Q	118_D	0.579	0.64
28_V	31_G	0.579	0.64
26_Q	39_S	0.572	0.63
34_A	55_R	0.568	0.62
83_M	88_Y	0.566	0.62
111_V	123_I	0.566	0.62
128_T	177_S	0.565	0.62
43_N	119_E	0.564	0.61
28_V	34_A	0.562	0.61
139_G	143_D	0.560	0.61
53_T	147_G	0.559	0.61
137_E	148_G	0.558	0.61
54_F	93_L	0.558	0.61
103_K	156_T	0.557	0.61
138_P	167_N	0.553	0.60
21_R	67_T	0.553	0.60
139_G	151_P	0.551	0.60
154_T	160_V	0.550	0.60
109_M	129_V	0.548	0.59
42_R	49_I	0.547	0.59
44_L	122_G	0.545	0.59
5_N	60_V	0.544	0.59
73_L	108_N	0.544	0.59
56_A	71_Q	0.542	0.58
132_K	170_D	0.541	0.58
71_Q	83_M	0.540	0.58
12_T	21_R	0.538	0.58
68_K	118_D	0.536	0.58
137_E	149_T	0.536	0.58
114_M	122_G	0.534	0.57
29_K	42_R	0.534	0.57
13_I	50_Q	0.531	0.57
19_I	117_Q	0.529	0.57
7_F	13_I	0.529	0.57
35_A	56_A	0.524	0.56
27_H	35_A	0.522	0.56
133_V	170_D	0.521	0.56
146_S	149_T	0.520	0.55
78_D	96_T	0.519	0.55
29_K	34_A	0.518	0.55
31_G	56_A	0.517	0.55
140_I	172_L	0.515	0.55
24_D	57_G	0.515	0.55
6_D	37_V	0.513	0.54
100_E	103_K	0.510	0.54
103_K	159_V	0.508	0.54
84_D	88_Y	0.508	0.54
129_V	156_T	0.507	0.54
147_G	165_F	0.503	0.53
125_L	128_T	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3treA	1	0.6973	100	0.048	Contact Map
1ybyA	2	0.9784	100	0.049	Contact Map
1uebA	1	0.9946	100	0.05	Contact Map
3a5zB	1	0.7243	100	0.051	Contact Map
3oyyA	1	0.9946	100	0.053	Contact Map
1bkbA	3	0.6865	100	0.496	Contact Map
1iz6A	1	0.6973	100	0.504	Contact Map
2eifA	1	0.6649	100	0.506	Contact Map
3er0A	1	0.7243	100	0.514	Contact Map
3hksA	1	0.7243	100	0.518	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.