QCRA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

QCRA - Menaquinol-cytochrome c reductase iron-sulfur subunit

UniProt:	P46911	Sequences: MGGKHDISRRQFLNYTLTGVGGFMAASMLMPMVRFALDPVLKSTGKQDMVQVVSVDELTKEPQRFDFKINQVDAWYESEESRSAWVFKNGDEIVALSPICKHLGCTVNWNSDPKNPNKFFCPCHYGLYEKDGTNVPGTPPLAPLDHYEQEVKDGFLYLGKAKPKGEG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	167 (147)
Sequences:	2911 (1784)
Seq/√Len:	147.1

BACSU - QCRA
SULSO - Q97UN2 Q97V31

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
126_G	140_P	4.861	1.00
79_E	83_S	3.155	1.00
118_K	127_L	2.929	1.00
142_A	145_D	2.920	1.00
29_L	32_M	2.852	1.00
22_G	26_A	2.705	1.00
76_Y	92_E	2.620	1.00
101_K	143_P	2.528	1.00
95_A	156_L	2.474	1.00
54_S	57_E	2.440	1.00
129_E	135_V	2.382	1.00
127_L	136_P	2.298	1.00
128_Y	142_A	2.196	1.00
152_K	155_F	2.195	1.00
97_S	145_D	2.176	1.00
98_P	106_T	2.017	1.00
128_Y	141_L	1.934	1.00
101_K	145_D	1.867	1.00
101_K	140_P	1.843	1.00
99_I	106_T	1.825	1.00
20_V	24_M	1.706	1.00
96_L	144_L	1.698	1.00
129_E	133_T	1.689	1.00
74_A	77_E	1.576	1.00
26_A	29_L	1.573	1.00
136_P	141_L	1.559	1.00
125_Y	136_P	1.553	1.00
96_L	146_H	1.551	1.00
87_F	90_G	1.545	1.00
51_Q	155_F	1.543	1.00
108_N	122_P	1.520	1.00
34_R	37_L	1.512	1.00
83_S	86_V	1.511	1.00
14_N	18_T	1.511	1.00
28_M	31_P	1.503	1.00
53_V	58_L	1.502	1.00
120_F	127_L	1.479	1.00
105_C	123_C	1.477	1.00
70_N	77_E	1.471	1.00
32_M	35_F	1.445	1.00
54_S	155_F	1.433	1.00
15_Y	19_G	1.429	1.00
101_K	128_Y	1.399	1.00
118_K	135_V	1.367	1.00
58_L	93_I	1.345	1.00
149_Q	156_L	1.343	1.00
58_L	63_Q	1.333	1.00
155_F	159_G	1.316	1.00
88_K	91_D	1.243	1.00
17_L	21_G	1.201	1.00
80_E	84_A	1.192	1.00
70_N	73_D	1.121	0.99
18_T	22_G	1.113	0.99
19_G	23_F	1.105	0.99
9_R	17_L	1.082	0.99
53_V	63_Q	1.080	0.99
27_S	31_P	1.075	0.99
154_G	159_G	1.068	0.99
21_G	25_A	1.036	0.99
60_K	79_E	1.035	0.99
78_S	81_S	1.032	0.99
72_V	158_L	1.025	0.99
21_G	24_M	1.021	0.99
15_Y	18_T	1.019	0.99
30_M	34_R	1.017	0.99
26_A	30_M	1.015	0.99
150_E	157_Y	1.005	0.99
120_F	125_Y	0.997	0.99
93_I	151_V	0.997	0.99
25_A	28_M	0.990	0.99
59_T	76_Y	0.979	0.98
23_F	27_S	0.977	0.98
23_F	26_A	0.975	0.98
35_F	39_P	0.968	0.98
71_Q	74_A	0.959	0.98
112_D	116_P	0.958	0.98
62_P	119_F	0.951	0.98
32_M	36_A	0.949	0.98
76_Y	79_E	0.932	0.98
95_A	149_Q	0.931	0.98
87_F	91_D	0.927	0.98
26_A	31_P	0.926	0.98
9_R	13_L	0.923	0.98
6_D	9_R	0.922	0.98
40_V	43_S	0.920	0.98
14_N	17_L	0.919	0.98
53_V	74_A	0.917	0.98
89_N	131_D	0.904	0.97
67_F	72_V	0.902	0.97
106_T	128_Y	0.899	0.97
96_L	109_W	0.894	0.97
98_P	128_Y	0.877	0.97
80_E	83_S	0.859	0.97
129_E	147_Y	0.857	0.96
147_Y	158_L	0.856	0.96
25_A	29_L	0.854	0.96
85_W	130_K	0.852	0.96
90_G	151_V	0.851	0.96
27_S	30_M	0.845	0.96
103_L	141_L	0.844	0.96
36_A	40_V	0.835	0.96
73_D	76_Y	0.833	0.96
40_V	45_G	0.831	0.96
154_G	157_Y	0.830	0.96
10_R	13_L	0.813	0.95
62_P	65_F	0.812	0.95
62_P	75_W	0.808	0.95
55_V	93_I	0.807	0.95
22_G	25_A	0.803	0.95
104_G	122_P	0.797	0.95
95_A	147_Y	0.792	0.95
75_W	85_W	0.789	0.94
71_Q	75_W	0.784	0.94
82_R	86_V	0.779	0.94
58_L	65_F	0.771	0.94
75_W	81_S	0.770	0.94
24_M	27_S	0.768	0.94
54_S	154_G	0.765	0.93
40_V	44_T	0.762	0.93
60_K	78_S	0.762	0.93
45_G	48_D	0.761	0.93
109_W	120_F	0.760	0.93
48_D	67_F	0.756	0.93
78_S	83_S	0.746	0.93
72_V	76_Y	0.741	0.92
57_E	60_K	0.740	0.92
152_K	157_Y	0.733	0.92
96_L	110_N	0.719	0.91
109_W	119_F	0.719	0.91
118_K	125_Y	0.718	0.91
70_N	74_A	0.709	0.91
39_P	42_K	0.705	0.90
31_P	35_F	0.703	0.90
69_I	77_E	0.698	0.90
75_W	119_F	0.696	0.90
106_T	122_P	0.693	0.90
74_A	78_S	0.682	0.89
101_K	144_L	0.681	0.89
41_L	106_T	0.680	0.89
8_S	15_Y	0.675	0.88
134_N	143_P	0.673	0.88
21_G	26_A	0.673	0.88
11_Q	14_N	0.672	0.88
7_I	11_Q	0.671	0.88
28_M	32_M	0.671	0.88
57_E	63_Q	0.671	0.88
33_V	38_D	0.668	0.88
71_Q	76_Y	0.667	0.88
78_S	82_R	0.667	0.88
68_K	71_Q	0.665	0.88
24_M	28_M	0.664	0.87
38_D	141_L	0.657	0.87
75_W	78_S	0.656	0.87
111_S	127_L	0.648	0.86
69_I	72_V	0.647	0.86
94_V	146_H	0.645	0.86
67_F	71_Q	0.639	0.85
71_Q	79_E	0.637	0.85
36_A	103_L	0.635	0.85
35_F	38_D	0.635	0.85
82_R	85_W	0.634	0.85
71_Q	78_S	0.634	0.85
72_V	79_E	0.629	0.85
12_F	15_Y	0.628	0.84
102_H	124_H	0.628	0.84
89_N	94_V	0.628	0.84
51_Q	141_L	0.627	0.84
88_K	92_E	0.623	0.84
152_K	156_L	0.617	0.83
31_P	36_A	0.611	0.83
68_K	145_D	0.606	0.82
38_D	42_K	0.604	0.82
72_V	78_S	0.600	0.82
73_D	77_E	0.598	0.81
65_F	119_F	0.597	0.81
33_V	36_A	0.595	0.81
42_K	56_D	0.593	0.81
9_R	15_Y	0.592	0.81
127_L	135_V	0.589	0.80
151_V	156_L	0.587	0.80
21_G	33_V	0.578	0.79
98_P	147_Y	0.574	0.79
65_F	68_K	0.574	0.79
12_F	109_W	0.572	0.79
89_N	92_E	0.571	0.78
18_T	25_A	0.569	0.78
37_L	40_V	0.568	0.78
125_Y	128_Y	0.567	0.78
45_G	49_M	0.566	0.78
11_Q	15_Y	0.566	0.78
20_V	23_F	0.564	0.78
21_G	31_P	0.563	0.77
112_D	135_V	0.562	0.77
65_F	72_V	0.560	0.77
11_Q	17_L	0.558	0.77
100_C	105_C	0.540	0.75
29_L	33_V	0.538	0.74
16_T	20_V	0.535	0.74
70_N	76_Y	0.534	0.74
58_L	67_F	0.532	0.73
72_V	77_E	0.531	0.73
35_F	103_L	0.530	0.73
24_M	37_L	0.530	0.73
18_T	116_P	0.528	0.73
70_N	79_E	0.527	0.73
13_L	31_P	0.525	0.72
90_G	149_Q	0.523	0.72
8_S	12_F	0.517	0.71
108_N	111_S	0.517	0.71
110_N	116_P	0.514	0.71
38_D	43_S	0.511	0.70
96_L	132_G	0.510	0.70
81_S	84_A	0.508	0.70
83_S	92_E	0.507	0.70
97_S	106_T	0.507	0.70
49_M	53_V	0.506	0.70
66_D	71_Q	0.503	0.69
64_R	69_I	0.502	0.69
54_S	58_L	0.502	0.69
102_H	105_C	0.500	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qjyC	2	0.8802	100	0.351	Contact Map
3cx5E	1	0.9162	100	0.362	Contact Map
4ogqD	1	0.8802	100	0.37	Contact Map
4aayB	1	0.7186	100	0.394	Contact Map
4d6tE	1	0.2814	100	0.4	Contact Map
1pp9E	1	0.9162	100	0.409	Contact Map
2nwfA	1	0.6527	99.9	0.543	Contact Map
1jm1A	1	0.8024	99.8	0.558	Contact Map
1nykA	1	0.7904	99.8	0.558	Contact Map
1rieA	1	0.6587	99.8	0.581	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.