RXL7 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RXL7 - Ribosome-associated protein L7Ae-like

UniProt:	P46350	Sequences: MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	82 (78)
Sequences:	343 (289)
Seq/√Len:	32.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_L	49_A	3.530	1.00
31_V	49_A	3.373	1.00
35_K	58_M	3.247	1.00
28_V	79_A	3.005	1.00
33_V	46_V	2.788	1.00
24_K	52_Q	2.204	0.99
4_D	21_K	2.015	0.98
31_V	45_V	1.804	0.96
23_L	54_I	1.787	0.96
43_S	47_S	1.714	0.94
24_K	49_A	1.665	0.94
44_S	72_E	1.635	0.93
30_E	57_S	1.609	0.92
19_T	45_V	1.590	0.92
41_L	63_K	1.582	0.92
60_E	64_K	1.563	0.91
16_T	45_V	1.490	0.89
23_L	31_V	1.463	0.88
28_V	31_V	1.361	0.84
45_V	49_A	1.337	0.83
37_A	62_M	1.300	0.81
47_S	50_E	1.269	0.80
5_K	78_V	1.229	0.77
16_T	41_L	1.224	0.77
31_V	56_V	1.210	0.76
21_K	70_G	1.203	0.76
32_V	61_S	1.159	0.73
35_K	51_D	1.157	0.73
21_K	25_R	1.155	0.73
32_V	78_V	1.136	0.71
31_V	40_I	1.130	0.71
6_V	32_V	1.092	0.68
6_V	78_V	1.084	0.68
38_D	41_L	1.077	0.67
6_V	9_A	1.063	0.66
23_L	45_V	1.051	0.65
24_K	51_D	1.047	0.65
7_S	32_V	1.045	0.65
33_V	38_D	1.029	0.64
24_K	77_A	1.028	0.64
26_G	52_Q	1.024	0.63
19_T	79_A	1.018	0.63
11_S	80_I	1.005	0.62
20_V	45_V	0.999	0.61
45_V	77_A	0.990	0.61
30_E	55_S	0.963	0.59
6_V	61_S	0.942	0.57
22_A	81_I	0.941	0.57
76_A	79_A	0.876	0.51
10_K	39_P	0.862	0.50
28_V	49_A	0.850	0.49
69_C	78_V	0.833	0.48
18_Q	74_G	0.828	0.47
5_K	30_E	0.821	0.47
43_S	53_G	0.820	0.47
37_A	42_T	0.819	0.47
28_V	44_S	0.815	0.46
46_V	58_M	0.803	0.45
29_K	57_S	0.779	0.43
33_V	58_M	0.779	0.43
26_G	55_S	0.770	0.43
9_A	76_A	0.766	0.42
43_S	54_I	0.763	0.42
40_I	62_M	0.747	0.41
8_Q	54_I	0.741	0.40
59_V	77_A	0.736	0.40
26_G	30_E	0.724	0.39
20_V	80_I	0.723	0.39
54_I	63_K	0.722	0.39
26_G	48_L	0.722	0.39
23_L	28_V	0.713	0.38
4_D	77_A	0.713	0.38
6_V	12_I	0.706	0.38
7_S	47_S	0.703	0.37
53_G	70_G	0.701	0.37
13_I	41_L	0.699	0.37
16_T	69_C	0.691	0.36
16_T	79_A	0.687	0.36
8_Q	77_A	0.687	0.36
17_K	58_M	0.675	0.35
7_S	70_G	0.674	0.35
14_I	48_L	0.661	0.34
10_K	48_L	0.660	0.34
44_S	49_A	0.659	0.34
8_Q	78_V	0.656	0.34
62_M	71_I	0.651	0.33
13_I	19_T	0.650	0.33
19_T	77_A	0.650	0.33
33_V	77_A	0.645	0.33
25_R	57_S	0.632	0.32
36_D	39_P	0.623	0.31
42_T	56_V	0.611	0.30
18_Q	65_L	0.600	0.30
35_K	64_K	0.590	0.29
38_D	47_S	0.589	0.29
47_S	51_D	0.582	0.28
40_I	80_I	0.580	0.28
38_D	62_M	0.578	0.28
47_S	53_G	0.572	0.28
59_V	68_A	0.557	0.27
54_I	77_A	0.554	0.27
23_L	72_E	0.550	0.26
61_S	64_K	0.550	0.26
5_K	8_Q	0.549	0.26
27_S	39_P	0.546	0.26
7_S	10_K	0.541	0.26
64_K	81_I	0.540	0.26
54_I	68_A	0.538	0.26
37_A	72_E	0.528	0.25
26_G	74_G	0.523	0.25
22_A	79_A	0.523	0.25
11_S	40_I	0.511	0.24
20_V	27_S	0.509	0.24
12_I	42_T	0.506	0.24
47_S	55_S	0.503	0.23
36_D	61_S	0.503	0.23
54_I	72_E	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cg6A	3	0.9634	99.6	0.494	Contact Map
3v7eA	1	0.9878	99.6	0.501	Contact Map
3ffmA	2	0.9146	99.6	0.511	Contact Map
1xbiA	1	1	99.6	0.52	Contact Map
3j61c	1	1	99.6	0.523	Contact Map
3zf7g	1	1	99.6	0.525	Contact Map
2jnbA	1	1	99.5	0.527	Contact Map
4a18G	1	1	99.5	0.528	Contact Map
3u5ec	1	1	99.5	0.529	Contact Map
1vx76	1	1	99.5	0.529	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.