ARSC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ARSC - Protein ArsC

UniProt:	P45947	Sequences: MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (127)
Sequences:	7721 (5277)
Seq/√Len:	468.3

ECOLI - WZB ETP
BACSU - ARSC YFKJ PAP
HALSA - ARSC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_Y	132_K	3.315	1.00
21_E	25_K	2.747	1.00
5_I	33_K	2.716	1.00
27_Y	128_G	2.162	1.00
104_D	126_E	2.083	1.00
128_G	132_K	2.068	1.00
52_M	59_I	2.054	1.00
54_E	121_Q	2.003	1.00
55_V	124_R	1.903	1.00
50_K	117_W	1.885	1.00
26_Q	30_D	1.867	1.00
11_T	85_A	1.840	1.00
83_G	102_G	1.816	1.00
55_V	128_G	1.803	1.00
8_F	24_A	1.674	1.00
51_A	124_R	1.665	1.00
19_M	48_A	1.665	1.00
25_K	34_V	1.658	1.00
115_E	119_F	1.656	1.00
19_M	52_M	1.654	1.00
7_Y	37_A	1.583	1.00
80_T	89_C	1.582	1.00
67_I	89_C	1.549	1.00
24_A	34_V	1.544	1.00
122_R	126_E	1.510	1.00
117_W	121_Q	1.509	1.00
94_P	101_W	1.497	1.00
51_A	121_Q	1.490	1.00
88_K	92_T	1.472	1.00
22_G	57_I	1.459	1.00
6_I	24_A	1.437	1.00
44_L	49_V	1.401	1.00
35_Y	65_D	1.384	1.00
98_R	101_W	1.369	1.00
41_A	66_I	1.364	1.00
55_V	125_D	1.363	1.00
80_T	86_A	1.338	1.00
11_T	40_E	1.331	1.00
23_W	55_V	1.317	1.00
28_L	32_W	1.310	1.00
119_F	122_R	1.304	1.00
51_A	54_E	1.297	1.00
23_W	124_R	1.291	1.00
44_L	62_Q	1.285	1.00
116_K	119_F	1.249	1.00
23_W	127_I	1.232	1.00
35_Y	75_A	1.224	1.00
22_G	59_I	1.215	1.00
70_D	74_N	1.215	1.00
23_W	131_L	1.212	1.00
50_K	54_E	1.161	1.00
47_N	117_W	1.149	1.00
19_M	124_R	1.144	1.00
12_G	107_A	1.134	1.00
39_I	88_K	1.125	1.00
54_E	117_W	1.123	1.00
47_N	50_K	1.119	1.00
5_I	35_Y	1.095	1.00
7_Y	75_A	1.094	1.00
95_H	98_R	1.088	1.00
27_Y	131_L	1.086	1.00
48_A	120_F	1.086	1.00
86_A	90_P	1.082	1.00
33_K	74_N	1.067	1.00
47_N	116_K	1.058	1.00
88_K	93_P	1.058	1.00
4_K	77_L	1.057	1.00
90_P	93_P	1.051	1.00
24_A	131_L	1.041	1.00
133_E	136_E	1.028	1.00
8_F	131_L	1.025	1.00
28_L	34_V	1.016	1.00
49_V	59_I	1.015	1.00
49_V	53_K	1.006	1.00
65_D	71_I	1.001	1.00
5_I	75_A	0.999	1.00
94_P	100_H	0.992	1.00
51_A	117_W	0.969	1.00
121_Q	125_D	0.948	1.00
57_I	128_G	0.947	1.00
94_P	97_K	0.946	1.00
5_I	74_N	0.944	1.00
79_V	134_F	0.942	1.00
45_N	120_F	0.939	1.00
8_F	20_A	0.937	1.00
88_K	91_M	0.933	1.00
51_A	55_V	0.924	1.00
23_W	128_G	0.919	1.00
77_L	134_F	0.917	1.00
23_W	57_I	0.913	1.00
104_D	122_R	0.910	1.00
22_G	62_Q	0.907	1.00
94_P	99_E	0.902	1.00
44_L	59_I	0.897	1.00
28_L	135_A	0.887	1.00
22_G	25_K	0.876	1.00
57_I	124_R	0.866	1.00
37_A	67_I	0.861	1.00
87_D	90_P	0.839	1.00
59_I	62_Q	0.836	1.00
72_L	78_V	0.832	1.00
37_A	65_D	0.826	1.00
11_T	84_D	0.815	1.00
27_Y	135_A	0.814	1.00
43_G	64_S	0.812	1.00
103_F	123_V	0.811	1.00
24_A	28_L	0.809	1.00
103_F	126_E	0.808	1.00
101_W	130_R	0.805	1.00
84_D	88_K	0.797	1.00
18_Q	44_L	0.790	1.00
52_M	57_I	0.788	1.00
20_A	127_I	0.783	1.00
24_A	32_W	0.779	1.00
20_A	81_L	0.779	1.00
46_P	50_K	0.778	1.00
23_W	52_M	0.776	1.00
48_A	51_A	0.775	1.00
96_V	99_E	0.752	1.00
22_G	44_L	0.745	1.00
35_Y	74_N	0.740	1.00
89_C	93_P	0.733	1.00
97_K	100_H	0.732	1.00
26_Q	57_I	0.724	1.00
125_D	129_N	0.721	1.00
72_L	75_A	0.719	1.00
95_H	101_W	0.717	1.00
103_F	127_I	0.713	1.00
119_F	123_V	0.712	1.00
69_S	92_T	0.712	1.00
94_P	98_R	0.709	1.00
68_D	71_I	0.706	1.00
127_I	131_L	0.697	1.00
123_V	127_I	0.695	1.00
129_N	133_E	0.695	1.00
8_F	81_L	0.691	1.00
82_C	85_A	0.689	1.00
11_T	82_C	0.681	1.00
70_D	73_N	0.679	1.00
124_R	128_G	0.674	1.00
53_K	59_I	0.671	1.00
25_K	33_K	0.669	1.00
71_I	75_A	0.661	1.00
40_E	66_I	0.660	1.00
50_K	53_K	0.652	1.00
81_L	85_A	0.646	1.00
126_E	130_R	0.643	1.00
118_A	122_R	0.630	0.99
96_V	101_W	0.627	0.99
58_D	61_N	0.626	0.99
15_C	120_F	0.622	0.99
23_W	27_Y	0.618	0.99
7_Y	78_V	0.614	0.99
55_V	121_Q	0.601	0.99
132_K	136_E	0.595	0.99
19_M	123_V	0.592	0.99
95_H	100_H	0.586	0.99
81_L	103_F	0.585	0.99
6_I	77_L	0.580	0.99
26_Q	128_G	0.579	0.99
12_G	40_E	0.574	0.99
96_V	100_H	0.569	0.99
83_G	87_D	0.561	0.99
67_I	72_L	0.559	0.99
123_V	126_E	0.558	0.99
39_I	85_A	0.552	0.99
83_G	86_A	0.550	0.99
20_A	131_L	0.549	0.99
40_E	88_K	0.549	0.99
97_K	101_W	0.548	0.99
22_G	60_S	0.546	0.99
11_T	88_K	0.544	0.99
45_N	48_A	0.542	0.98
12_G	15_C	0.541	0.98
42_H	64_S	0.540	0.98
104_D	123_V	0.540	0.98
7_Y	67_I	0.539	0.98
8_F	134_F	0.536	0.98
108_R	116_K	0.533	0.98
53_K	58_D	0.532	0.98
8_F	79_V	0.532	0.98
19_M	51_A	0.526	0.98
68_D	74_N	0.523	0.98
26_Q	29_G	0.520	0.98
27_Y	30_D	0.516	0.98
69_S	73_N	0.509	0.98
72_L	93_P	0.507	0.98
14_S	120_F	0.504	0.98
13_N	17_S	0.502	0.98
47_N	108_R	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jl3A	1	0.9856	100	0.116	Contact Map
1jf8A	1	0.9353	100	0.124	Contact Map
3rh0A	1	0.9209	100	0.136	Contact Map
3t38A	2	0.8993	100	0.152	Contact Map
1p8aA	1	0.9496	100	0.157	Contact Map
2l17A	1	0.9353	100	0.16	Contact Map
3jviA	1	0.9209	100	0.16	Contact Map
4picA	2	0.9353	100	0.161	Contact Map
4lrqA	2	0.9424	100	0.163	Contact Map
2cwdA	1	0.9496	100	0.169	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.