YQAN - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQAN - Uncharacterized protein YqaN

UniProt:	P45911	Sequences: MDCIKFTVYGEPVAQGRPRGSIRNGKVHMRDPAKSKYFKQYVALVASQHRPETIITGPVSMDVKVYRPMPKSVSNSKKKKEKAEKGLLRPTTKPDVDNYVKGVKDALNHLIYKDDSQVVDLKVSKFYSEEPRVEVMIREVSA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	142 (132)
Sequences:	313 (260)
Seq/√Len:	22.6

BACSU - YQAN

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_G	29_M	3.992	1.00
15_Q	39_K	3.267	1.00
15_Q	31_D	3.060	1.00
15_Q	35_S	3.013	1.00
31_D	35_S	3.012	1.00
31_D	39_K	3.008	1.00
65_V	99_Y	2.942	0.99
97_D	104_K	2.932	0.99
35_S	39_K	2.694	0.99
73_V	83_A	2.684	0.99
120_D	124_S	2.484	0.98
100_V	121_L	2.468	0.98
61_M	104_K	2.343	0.97
55_I	59_V	2.268	0.97
100_V	123_V	2.204	0.96
5_K	136_M	2.168	0.96
70_P	83_A	2.149	0.95
50_R	111_I	1.696	0.86
66_Y	132_R	1.693	0.86
89_R	126_F	1.656	0.84
108_N	114_D	1.643	0.84
33_A	37_Y	1.634	0.84
60_S	138_R	1.568	0.81
66_Y	128_S	1.565	0.81
107_L	111_I	1.534	0.79
79_K	88_L	1.488	0.77
100_V	104_K	1.473	0.76
16_G	35_S	1.473	0.76
73_V	79_K	1.456	0.76
79_K	82_K	1.452	0.75
7_T	134_E	1.424	0.74
104_K	121_L	1.410	0.73
81_E	85_K	1.395	0.72
10_G	65_V	1.394	0.72
96_V	123_V	1.382	0.72
104_K	118_V	1.334	0.69
18_P	29_M	1.292	0.66
14_A	116_S	1.283	0.66
25_G	28_H	1.272	0.65
12_P	30_R	1.257	0.64
46_A	111_I	1.237	0.63
83_A	88_L	1.190	0.60
76_S	83_A	1.184	0.59
67_R	99_Y	1.175	0.59
21_S	24_N	1.173	0.59
31_D	99_Y	1.169	0.58
63_V	100_V	1.150	0.57
13_V	16_G	1.146	0.57
90_P	99_Y	1.132	0.56
54_I	58_P	1.121	0.55
22_I	25_G	1.113	0.55
12_P	131_P	1.081	0.52
15_Q	99_Y	1.078	0.52
9_Y	45_V	1.076	0.52
31_D	111_I	1.075	0.52
89_R	119_V	1.072	0.52
38_F	69_M	1.072	0.52
42_V	103_V	1.057	0.51
107_L	112_Y	1.057	0.51
7_T	132_R	1.041	0.50
6_F	135_V	1.039	0.50
35_S	99_Y	1.037	0.49
61_M	137_I	1.037	0.49
11_E	131_P	1.031	0.49
23_R	28_H	1.021	0.48
56_T	113_K	1.019	0.48
16_G	32_P	0.975	0.45
11_E	34_K	0.950	0.43
21_S	28_H	0.948	0.43
70_P	92_T	0.946	0.43
22_I	29_M	0.934	0.42
39_K	99_Y	0.933	0.42
80_K	129_E	0.926	0.42
123_V	133_V	0.921	0.41
42_V	65_V	0.920	0.41
64_K	134_E	0.911	0.41
113_K	117_Q	0.907	0.41
13_V	34_K	0.893	0.40
70_P	73_V	0.893	0.40
57_G	93_K	0.892	0.40
79_K	83_A	0.880	0.39
107_L	129_E	0.875	0.38
21_S	25_G	0.872	0.38
78_K	82_K	0.861	0.38
11_E	68_P	0.860	0.37
7_T	68_P	0.857	0.37
99_Y	112_Y	0.852	0.37
42_V	133_V	0.852	0.37
67_R	70_P	0.850	0.37
35_S	102_G	0.835	0.36
16_G	102_G	0.832	0.36
90_P	119_V	0.812	0.34
62_D	136_M	0.812	0.34
18_P	24_N	0.812	0.34
38_F	102_G	0.811	0.34
14_A	99_Y	0.810	0.34
69_M	84_E	0.807	0.34
70_P	79_K	0.801	0.34
67_R	90_P	0.781	0.33
112_Y	116_S	0.779	0.32
127_Y	131_P	0.768	0.32
73_V	88_L	0.759	0.31
9_Y	133_V	0.759	0.31
21_S	33_A	0.751	0.31
14_A	94_P	0.751	0.31
8_V	106_A	0.747	0.30
40_Q	44_L	0.747	0.30
14_A	108_N	0.738	0.30
61_M	80_K	0.735	0.30
6_F	49_H	0.735	0.30
46_A	54_I	0.732	0.30
7_T	103_V	0.726	0.29
70_P	88_L	0.709	0.28
68_P	131_P	0.706	0.28
8_V	32_P	0.693	0.27
62_D	122_K	0.691	0.27
54_I	112_Y	0.684	0.27
103_V	133_V	0.683	0.27
37_Y	58_P	0.680	0.27
56_T	78_K	0.675	0.26
70_P	112_Y	0.665	0.26
62_D	138_R	0.659	0.26
65_V	121_L	0.657	0.25
69_M	131_P	0.652	0.25
29_M	110_L	0.651	0.25
61_M	127_Y	0.647	0.25
33_A	43_A	0.644	0.25
6_F	42_V	0.639	0.25
55_I	77_K	0.635	0.24
12_P	32_P	0.634	0.24
16_G	31_D	0.631	0.24
66_Y	126_F	0.631	0.24
41_Y	56_T	0.629	0.24
31_D	90_P	0.625	0.24
55_I	129_E	0.625	0.24
24_N	29_M	0.618	0.24
5_K	134_E	0.614	0.23
21_S	29_M	0.613	0.23
54_I	113_K	0.613	0.23
58_P	68_P	0.613	0.23
120_D	126_F	0.611	0.23
60_S	120_D	0.611	0.23
8_V	103_V	0.610	0.23
53_T	112_Y	0.608	0.23
95_D	101_K	0.607	0.23
98_N	101_K	0.607	0.23
95_D	98_N	0.607	0.23
14_A	35_S	0.607	0.23
71_K	85_K	0.607	0.23
23_R	29_M	0.607	0.23
96_V	100_V	0.607	0.23
10_G	42_V	0.605	0.23
95_D	115_D	0.595	0.22
101_K	115_D	0.595	0.22
98_N	115_D	0.595	0.22
8_V	42_V	0.590	0.22
46_A	107_L	0.579	0.22
49_H	86_G	0.577	0.22
43_A	130_E	0.576	0.21
31_D	46_A	0.576	0.21
56_T	138_R	0.573	0.21
83_A	92_T	0.568	0.21
67_R	71_K	0.563	0.21
35_S	108_N	0.562	0.21
15_Q	111_I	0.562	0.21
20_G	30_R	0.561	0.21
20_G	24_N	0.558	0.21
72_S	137_I	0.554	0.20
86_G	90_P	0.549	0.20
81_E	96_V	0.549	0.20
90_P	127_Y	0.548	0.20
63_V	126_F	0.545	0.20
62_D	124_S	0.544	0.20
9_Y	57_G	0.542	0.20
33_A	52_E	0.542	0.20
116_S	132_R	0.532	0.20
82_K	87_L	0.530	0.19
66_Y	130_E	0.528	0.19
95_D	105_D	0.525	0.19
101_K	105_D	0.525	0.19
98_N	105_D	0.525	0.19
119_V	131_P	0.523	0.19
49_H	130_E	0.523	0.19
58_P	81_E	0.522	0.19
16_G	36_K	0.519	0.19
14_A	93_K	0.518	0.19
46_A	50_R	0.516	0.19
102_G	137_I	0.516	0.19
28_H	34_K	0.515	0.19
107_L	118_V	0.514	0.19
67_R	83_A	0.513	0.19
105_D	115_D	0.512	0.19
13_V	32_P	0.512	0.19
46_A	83_A	0.512	0.19
23_R	128_S	0.506	0.18
80_K	89_R	0.506	0.18
13_V	106_A	0.506	0.18
106_A	135_V	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2h8eA	2	0.8239	100	0.475	Contact Map
3mp6A	1	0.507	33.3	0.938	Contact Map
2qv7A	2	0.3521	8.7	0.953	Contact Map
3zieA	2	0.5634	7.3	0.954	Contact Map
2qiyA	2	0.338	6.1	0.956	Contact Map
2qtpA	2	0.1831	6	0.956	Contact Map
3byqA	5	0.331	5.8	0.956	Contact Map
2iueA	1	0.6831	5	0.958	Contact Map
4b7lA	1	0.4014	4.1	0.96	Contact Map
3b47A	2	0.3803	4.1	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.