YQAL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQAL - Uncharacterized protein YqaL

UniProt:	P45909	Sequences: MDIKAMGYVVIPRLPFKEFRDEKIYDHLFKRAEYRPNQELELGQTIIKVVELAKDFNWSAAQIKYSLDRMEKQGYIKLHRLPQKRGLIVTILHYADYIQLGNYMKNKALEPAQIEHQEVDDKMKNAFELYENKVARSVGPMEAQRIGYMVDDYGEEKVMEAIKTAFQLKGKAASLSYVQAILSNPFTQKRKEKQYGYKQSSQYRHRISNDHAGTSGKVSPLFGNKTGRIRRKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	233 (199)
Sequences:	871 (732)
Seq/√Len:	51.9

BACSU - YQAL DNAD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_V	13_R	5.024	1.00
190_R	196_G	5.017	1.00
188_Q	199_Q	4.561	1.00
136_R	142_E	4.117	1.00
164_T	200_S	3.592	1.00
190_R	199_Q	3.346	1.00
157_K	196_G	3.126	1.00
191_K	195_Y	2.923	1.00
94_Y	98_I	2.867	1.00
96_D	100_L	2.835	1.00
190_R	195_Y	2.720	1.00
165_A	178_V	2.660	1.00
160_E	163_K	2.599	1.00
94_Y	97_Y	2.361	1.00
145_R	179_Q	2.320	1.00
198_K	201_S	2.244	1.00
18_E	21_D	2.176	1.00
161_A	182_L	2.104	1.00
130_Y	166_F	2.089	1.00
149_M	179_Q	2.054	1.00
133_K	166_F	2.036	1.00
130_Y	162_I	1.935	0.99
157_K	190_R	1.897	0.99
154_G	157_K	1.857	0.99
162_I	178_V	1.847	0.99
157_K	193_K	1.811	0.99
147_G	151_D	1.777	0.99
129_L	159_M	1.774	0.99
126_A	162_I	1.584	0.98
127_F	138_V	1.545	0.97
25_Y	28_L	1.535	0.97
94_Y	100_L	1.533	0.97
196_G	200_S	1.529	0.97
52_L	63_I	1.514	0.97
27_H	30_K	1.512	0.97
127_F	151_D	1.512	0.97
28_L	31_R	1.509	0.97
131_E	138_V	1.500	0.97
194_Q	197_Y	1.496	0.97
160_E	164_T	1.469	0.97
169_K	176_S	1.403	0.95
172_A	180_A	1.393	0.95
98_I	101_G	1.385	0.95
31_R	52_L	1.379	0.95
180_A	183_S	1.377	0.95
141_M	175_L	1.358	0.95
99_Q	109_L	1.356	0.95
130_Y	178_V	1.352	0.94
130_Y	133_K	1.343	0.94
139_G	144_Q	1.343	0.94
23_K	28_L	1.339	0.94
135_A	142_E	1.337	0.94
49_V	67_L	1.336	0.94
28_L	66_S	1.332	0.94
17_K	38_Q	1.322	0.94
142_E	175_L	1.309	0.93
50_V	60_A	1.289	0.93
53_A	59_S	1.283	0.93
160_E	193_K	1.260	0.92
162_I	166_F	1.259	0.92
130_Y	136_R	1.244	0.92
128_E	131_E	1.236	0.91
184_N	188_Q	1.235	0.91
116_H	119_V	1.203	0.90
24_I	75_Y	1.192	0.90
164_T	182_L	1.187	0.90
79_H	93_H	1.183	0.89
136_R	175_L	1.175	0.89
148_Y	152_D	1.161	0.88
48_K	51_E	1.158	0.88
164_T	180_A	1.157	0.88
161_A	165_A	1.156	0.88
130_Y	142_E	1.153	0.88
146_I	184_N	1.150	0.88
150_V	153_Y	1.137	0.87
135_A	162_I	1.135	0.87
197_Y	201_S	1.106	0.86
48_K	90_T	1.102	0.86
69_R	73_Q	1.100	0.86
96_D	101_G	1.088	0.85
143_A	176_S	1.087	0.85
70_M	182_L	1.072	0.84
47_I	92_L	1.059	0.83
9_V	33_E	1.040	0.82
133_K	139_G	1.037	0.82
68_D	72_K	1.036	0.82
136_R	179_Q	1.035	0.82
29_F	33_E	1.031	0.82
43_G	67_L	1.016	0.81
10_V	13_R	1.011	0.80
11_I	16_F	1.011	0.80
104_M	107_K	1.006	0.80
141_M	174_S	0.998	0.80
164_T	181_I	0.989	0.79
76_I	84_K	0.986	0.79
130_Y	175_L	0.974	0.78
156_E	196_G	0.968	0.77
23_K	27_H	0.964	0.77
26_D	30_K	0.964	0.77
176_S	179_Q	0.962	0.77
130_Y	165_A	0.960	0.77
105_K	108_A	0.956	0.77
52_L	55_D	0.956	0.77
145_R	175_L	0.954	0.76
143_A	147_G	0.942	0.75
86_G	91_I	0.941	0.75
15_P	29_F	0.932	0.75
150_V	158_V	0.929	0.74
117_Q	120_D	0.926	0.74
136_R	149_M	0.911	0.73
134_V	142_E	0.907	0.73
37_N	41_E	0.902	0.72
115_E	119_V	0.898	0.72
19_F	26_D	0.896	0.72
28_L	33_E	0.896	0.72
14_L	17_K	0.886	0.71
50_V	54_K	0.880	0.70
98_I	104_M	0.876	0.70
53_A	60_A	0.875	0.70
126_A	159_M	0.872	0.70
193_K	197_Y	0.865	0.69
195_Y	207_I	0.860	0.69
115_E	120_D	0.850	0.68
113_Q	116_H	0.850	0.68
100_L	104_M	0.849	0.68
129_L	133_K	0.846	0.67
174_S	178_V	0.843	0.67
153_Y	164_T	0.840	0.67
56_F	66_S	0.839	0.67
171_K	184_N	0.838	0.67
13_R	17_K	0.836	0.66
161_A	181_I	0.832	0.66
195_Y	199_Q	0.831	0.66
155_E	159_M	0.830	0.66
142_E	162_I	0.826	0.65
149_M	186_F	0.819	0.65
110_E	114_I	0.819	0.65
116_H	120_D	0.819	0.65
113_Q	117_Q	0.816	0.65
184_N	190_R	0.815	0.64
20_R	57_N	0.810	0.64
22_E	29_F	0.805	0.63
157_K	205_H	0.805	0.63
208_S	212_A	0.801	0.63
126_A	150_V	0.800	0.63
172_A	175_L	0.798	0.63
204_R	207_I	0.793	0.62
130_Y	139_G	0.787	0.62
9_V	16_F	0.781	0.61
192_E	202_Q	0.775	0.60
145_R	196_G	0.766	0.60
162_I	172_A	0.766	0.60
18_E	81_L	0.761	0.59
149_M	181_I	0.760	0.59
99_Q	104_M	0.758	0.59
24_I	28_L	0.754	0.58
109_L	114_I	0.751	0.58
201_S	205_H	0.749	0.58
35_R	39_E	0.740	0.57
24_I	30_K	0.738	0.57
133_K	169_K	0.736	0.57
70_M	161_A	0.734	0.56
23_K	29_F	0.733	0.56
122_K	154_G	0.729	0.56
15_P	22_E	0.725	0.55
126_A	131_E	0.724	0.55
16_F	20_R	0.721	0.55
127_F	146_I	0.720	0.55
22_E	31_R	0.715	0.54
139_G	166_F	0.713	0.54
193_K	196_G	0.711	0.54
145_R	160_E	0.710	0.54
130_Y	146_I	0.708	0.54
115_E	118_E	0.705	0.53
81_L	89_V	0.700	0.53
114_I	117_Q	0.698	0.53
76_I	194_Q	0.695	0.52
63_I	93_H	0.694	0.52
46_I	78_L	0.694	0.52
135_A	138_V	0.693	0.52
118_E	121_D	0.693	0.52
21_D	27_H	0.692	0.52
13_R	16_F	0.691	0.52
127_F	147_G	0.690	0.52
47_I	52_L	0.685	0.51
126_A	146_I	0.677	0.50
110_E	117_Q	0.675	0.50
161_A	164_T	0.675	0.50
165_A	182_L	0.674	0.50
24_I	29_F	0.669	0.50
170_G	200_S	0.664	0.49
12_P	76_I	0.663	0.49
27_H	33_E	0.663	0.49
48_K	78_L	0.663	0.49
165_A	181_I	0.662	0.49
146_I	204_R	0.661	0.49
175_L	193_K	0.658	0.48
11_I	29_F	0.658	0.48
134_V	179_Q	0.657	0.48
53_A	63_I	0.657	0.48
15_P	19_F	0.652	0.48
173_A	180_A	0.649	0.47
73_Q	93_H	0.649	0.47
28_L	69_R	0.648	0.47
143_A	170_G	0.647	0.47
97_Y	101_G	0.645	0.47
141_M	169_K	0.643	0.47
144_Q	163_K	0.641	0.47
62_Q	65_Y	0.641	0.47
33_E	38_Q	0.640	0.47
85_R	90_T	0.637	0.46
35_R	38_Q	0.634	0.46
72_K	194_Q	0.634	0.46
177_Y	181_I	0.631	0.46
127_F	174_S	0.629	0.45
23_K	30_K	0.628	0.45
99_Q	108_A	0.628	0.45
40_L	63_I	0.621	0.45
146_I	150_V	0.620	0.44
25_Y	32_A	0.618	0.44
76_I	107_K	0.618	0.44
29_F	32_A	0.615	0.44
138_V	145_R	0.615	0.44
145_R	176_S	0.610	0.43
37_N	53_A	0.609	0.43
95_A	99_Q	0.604	0.43
80_R	89_V	0.602	0.43
159_M	174_S	0.599	0.42
163_K	192_E	0.597	0.42
94_Y	101_G	0.595	0.42
121_D	205_H	0.593	0.42
11_I	106_N	0.592	0.42
28_L	32_A	0.590	0.41
157_K	185_P	0.589	0.41
110_E	113_Q	0.588	0.41
153_Y	179_Q	0.588	0.41
171_K	189_K	0.588	0.41
129_L	198_K	0.585	0.41
152_D	198_K	0.584	0.41
138_V	180_A	0.582	0.41
189_K	196_G	0.581	0.40
65_Y	193_K	0.580	0.40
19_F	136_R	0.574	0.40
169_K	179_Q	0.571	0.39
134_V	145_R	0.570	0.39
95_A	98_I	0.569	0.39
95_A	102_N	0.569	0.39
176_S	204_R	0.567	0.39
131_E	136_R	0.563	0.39
136_R	178_V	0.561	0.38
75_Y	93_H	0.560	0.38
195_Y	198_K	0.559	0.38
110_E	122_K	0.556	0.38
174_S	187_T	0.552	0.38
59_S	69_R	0.549	0.37
146_I	170_G	0.549	0.37
78_L	90_T	0.548	0.37
137_S	183_S	0.546	0.37
179_Q	186_F	0.544	0.37
207_I	210_D	0.542	0.37
130_Y	137_S	0.541	0.37
179_Q	183_S	0.541	0.37
149_M	182_L	0.540	0.36
153_Y	171_K	0.539	0.36
40_L	67_L	0.538	0.36
183_S	197_Y	0.538	0.36
159_M	189_K	0.536	0.36
103_Y	107_K	0.536	0.36
153_Y	157_K	0.535	0.36
176_S	196_G	0.534	0.36
14_L	18_E	0.531	0.36
124_K	132_N	0.531	0.36
121_D	125_N	0.530	0.35
42_L	47_I	0.528	0.35
85_R	94_Y	0.525	0.35
208_S	211_H	0.524	0.35
26_D	29_F	0.521	0.35
202_Q	205_H	0.520	0.35
129_L	132_N	0.519	0.34
126_A	158_V	0.519	0.34
105_K	109_L	0.518	0.34
144_Q	172_A	0.517	0.34
172_A	176_S	0.512	0.34
39_E	55_D	0.512	0.34
138_V	162_I	0.511	0.34
131_E	187_T	0.510	0.34
99_Q	106_N	0.508	0.33
162_I	179_Q	0.506	0.33
149_M	175_L	0.505	0.33
31_R	66_S	0.505	0.33
160_E	173_A	0.504	0.33
133_K	163_K	0.504	0.33
138_V	155_E	0.504	0.33
83_Q	89_V	0.503	0.33
48_K	87_L	0.503	0.33
36_P	39_E	0.502	0.33
120_D	156_E	0.500	0.33
146_I	166_F	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2i5uA	1	0.2918	99.8	0.603	Contact Map
2zc2A	1	0.3133	99.8	0.608	Contact Map
2v79A	4	0.4764	99.4	0.726	Contact Map
2vn2A	4	0.4464	98.7	0.794	Contact Map
4ptaD	3	0.4506	97.4	0.852	Contact Map
4pt7A	3	0.4807	97.3	0.855	Contact Map
3jw4A	2	0.515	96	0.876	Contact Map
4mnuA	2	0.6266	95.7	0.878	Contact Map
3u2rA	4	0.5408	95.6	0.879	Contact Map
3broA	2	0.5708	95.6	0.879	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.