YQAE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQAE - Uncharacterized HTH-type transcriptional regulator YqaE

UniProt:	P45902	Sequences: MFSENLKKCRKQKKLTQQNMADKLGITRPAYTAYELGSREPDYKTLINISNILDVSLDYLLKGESNEKVFQDEAKKVLNDPETFLAAKDGEVTDEILQAALEIITEQLKERRKSDK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	116 (107)
Sequences:	1343 (1205)
Seq/√Len:	116.5

ECOLI - DICA
BACSU - YQAE YOBD ANSR YONR RGHRB SLRR RGHR IMMR XRE SINR YQAF YGZD YAZB
HALSA - O51961 Q9HRZ8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_M	31_Y	3.133	1.00
18_Q	22_D	3.003	1.00
18_Q	28_R	2.785	1.00
2_F	6_L	2.735	1.00
51_N	63_G	2.665	1.00
3_S	37_G	2.456	1.00
15_L	52_I	2.434	1.00
27_T	30_A	2.174	1.00
29_P	33_A	2.154	1.00
57_L	61_L	2.145	1.00
23_K	52_I	2.093	1.00
26_I	31_Y	2.040	1.00
9_C	53_L	2.033	1.00
10_R	35_E	1.970	1.00
12_Q	67_E	1.902	1.00
93_T	96_I	1.889	1.00
40_E	43_Y	1.885	1.00
20_M	53_L	1.867	1.00
33_A	39_R	1.763	1.00
33_A	38_S	1.698	1.00
103_I	106_E	1.680	1.00
29_P	32_T	1.580	1.00
99_A	106_E	1.549	1.00
30_A	33_A	1.496	1.00
58_D	63_G	1.491	1.00
6_L	31_Y	1.463	1.00
15_L	23_K	1.428	1.00
17_Q	28_R	1.426	1.00
26_I	30_A	1.383	1.00
103_I	107_Q	1.381	1.00
28_R	32_T	1.379	1.00
50_S	63_G	1.374	1.00
43_Y	46_L	1.329	1.00
20_M	49_I	1.302	1.00
5_N	59_Y	1.280	0.99
102_E	106_E	1.253	0.99
92_V	104_I	1.246	0.99
64_E	67_E	1.171	0.99
32_T	36_L	1.166	0.99
34_Y	39_R	1.159	0.99
86_A	89_D	1.132	0.99
92_V	97_L	1.123	0.99
27_T	33_A	1.110	0.99
34_Y	45_T	1.103	0.98
45_T	48_N	1.095	0.98
42_D	45_T	1.078	0.98
46_L	57_L	1.078	0.98
5_N	62_K	1.063	0.98
19_N	22_D	1.061	0.98
99_A	103_I	1.042	0.98
46_L	61_L	1.031	0.98
40_E	45_T	1.024	0.98
2_F	43_Y	1.023	0.97
33_A	36_L	1.019	0.97
28_R	36_L	1.018	0.97
100_A	104_I	1.006	0.97
96_I	99_A	0.998	0.97
5_N	63_G	0.994	0.97
16_T	19_N	0.962	0.96
6_L	53_L	0.959	0.96
25_G	48_N	0.949	0.96
5_N	65_S	0.949	0.96
24_L	49_I	0.920	0.95
27_T	32_T	0.919	0.95
5_N	8_K	0.895	0.95
55_V	59_Y	0.890	0.94
13_K	23_K	0.890	0.94
41_P	58_D	0.884	0.94
84_F	89_D	0.878	0.94
99_A	107_Q	0.876	0.94
100_A	107_Q	0.870	0.94
21_A	28_R	0.867	0.94
17_Q	31_Y	0.863	0.93
50_S	57_L	0.854	0.93
28_R	33_A	0.838	0.92
26_I	34_Y	0.831	0.92
20_M	52_I	0.823	0.92
19_N	23_K	0.818	0.91
66_N	70_F	0.816	0.91
99_A	102_E	0.811	0.91
105_T	108_L	0.810	0.91
15_L	19_N	0.802	0.91
4_E	37_G	0.795	0.90
21_A	33_A	0.795	0.90
2_F	53_L	0.786	0.90
85_L	88_K	0.766	0.89
32_T	41_P	0.765	0.89
9_C	55_V	0.757	0.88
101_L	104_I	0.757	0.88
101_L	105_T	0.756	0.88
83_T	89_D	0.755	0.88
8_K	12_Q	0.754	0.88
2_F	60_L	0.733	0.86
17_Q	21_A	0.728	0.86
101_L	107_Q	0.725	0.86
21_A	31_Y	0.719	0.85
28_R	42_D	0.718	0.85
82_E	89_D	0.703	0.84
82_E	90_G	0.698	0.84
21_A	29_P	0.692	0.83
24_L	52_I	0.689	0.83
46_L	58_D	0.686	0.82
26_I	29_P	0.680	0.82
32_T	39_R	0.679	0.82
28_R	38_S	0.678	0.82
93_T	99_A	0.654	0.79
32_T	42_D	0.644	0.78
85_L	103_I	0.643	0.78
9_C	52_I	0.640	0.78
54_D	68_K	0.637	0.78
34_Y	41_P	0.636	0.77
74_A	78_L	0.635	0.77
92_V	100_A	0.628	0.77
104_I	107_Q	0.626	0.76
50_S	62_K	0.623	0.76
52_I	55_V	0.612	0.75
103_I	108_L	0.594	0.73
89_D	97_L	0.591	0.72
91_E	103_I	0.588	0.72
29_P	39_R	0.586	0.72
6_L	20_M	0.584	0.71
29_P	43_Y	0.577	0.70
18_Q	32_T	0.572	0.70
39_R	42_D	0.571	0.70
7_K	28_R	0.570	0.69
72_D	80_D	0.568	0.69
39_R	43_Y	0.562	0.68
44_K	48_N	0.557	0.68
98_Q	102_E	0.554	0.67
29_P	36_L	0.553	0.67
29_P	38_S	0.552	0.67
82_E	88_K	0.550	0.67
84_F	87_A	0.549	0.67
85_L	101_L	0.547	0.66
26_I	49_I	0.547	0.66
43_Y	47_I	0.546	0.66
97_L	101_L	0.544	0.66
75_K	79_N	0.544	0.66
9_C	59_Y	0.542	0.66
84_F	88_K	0.542	0.66
73_E	76_K	0.541	0.66
20_M	23_K	0.539	0.65
81_P	86_A	0.538	0.65
96_I	102_E	0.531	0.64
7_K	18_Q	0.531	0.64
20_M	24_L	0.529	0.64
7_K	10_R	0.528	0.64
96_I	103_I	0.527	0.64
66_N	69_V	0.524	0.63
4_E	8_K	0.523	0.63
97_L	108_L	0.512	0.61
74_A	80_D	0.511	0.61
82_E	104_I	0.511	0.61
74_A	79_N	0.510	0.61
64_E	69_V	0.510	0.61
89_D	93_T	0.510	0.61
88_K	105_T	0.505	0.60
68_K	95_E	0.504	0.60
21_A	48_N	0.503	0.60
83_T	101_L	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ndwA	2	0.9828	99.8	0.363	Contact Map
4o8bA	2	0.8362	99.8	0.376	Contact Map
3r1fA	2	0.9828	99.8	0.378	Contact Map
3qwgA	2	0.6724	99.8	0.397	Contact Map
4jcyA	2	0.7586	99.8	0.399	Contact Map
1b0nA	2	0.8621	99.8	0.4	Contact Map
3op9A	4	0.8966	99.7	0.408	Contact Map
3ivpA	2	0.9138	99.7	0.414	Contact Map
2ebyA	2	0.8448	99.7	0.437	Contact Map
2p5tA	2	0.3793	99.7	0.451	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.