YQAC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQAC - Uncharacterized protein YqaC

UniProt:	P45900	Sequences: MKKNIHILGASGVGTSTLGAALSKRLPHTHLDTDNYYWLDKFTKKREIPERRKLLEKDLTINEKWILSGAVCGWGDNLKSYFDLVVFLWIPQDIRLERLRHREFQRYGNEVLAGGSKYEQSKTFLEWASLYDNAGMEVRSRALHEHWMADLSCPVLKIEDDCSVNERVDRVLDYLSSN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	178 (134)
Sequences:	5742 (3563)
Seq/√Len:	307.8

ECOLI - KAD AROL AROK
BACSU - YQAC KAD AROK
HALSA - KAD KCY KAD6 Y2452
SULSO - KAD6 KCY Y1041

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
105_Q	108_G	4.221	1.00
37_Y	51_R	3.452	1.00
92_Q	122_K	3.345	1.00
79_K	82_F	3.045	1.00
75_G	78_L	2.665	1.00
52_R	70_A	2.498	1.00
40_D	57_K	2.447	1.00
105_Q	109_N	2.266	1.00
120_Q	124_F	2.212	1.00
94_I	97_E	2.125	1.00
119_E	123_T	2.065	1.00
47_E	50_E	2.058	1.00
116_S	119_E	2.037	1.00
58_D	61_I	1.982	1.00
101_H	104_F	1.905	1.00
126_E	130_L	1.904	1.00
106_R	109_N	1.860	1.00
23_S	30_H	1.748	1.00
99_L	114_G	1.733	1.00
130_L	134_A	1.727	1.00
111_V	115_G	1.715	1.00
20_A	24_K	1.664	1.00
110_E	113_A	1.642	1.00
29_T	58_D	1.620	1.00
74_W	78_L	1.596	1.00
13_V	90_I	1.577	1.00
7_I	19_G	1.549	1.00
31_L	58_D	1.546	1.00
46_R	54_L	1.515	1.00
122_K	126_E	1.368	1.00
130_L	133_N	1.356	1.00
40_D	54_L	1.348	1.00
56_E	60_T	1.345	1.00
21_A	24_K	1.329	1.00
100_R	111_V	1.318	1.00
96_L	115_G	1.315	1.00
48_I	73_G	1.299	1.00
53_K	56_E	1.297	1.00
113_A	116_S	1.289	1.00
50_E	53_K	1.285	1.00
34_D	38_W	1.246	1.00
7_I	22_L	1.209	1.00
20_A	30_H	1.200	1.00
112_L	118_Y	1.198	1.00
57_K	61_I	1.191	1.00
131_Y	135_G	1.188	1.00
96_L	100_R	1.177	1.00
44_K	116_S	1.165	1.00
121_S	125_L	1.153	1.00
10_A	95_R	1.147	1.00
93_D	97_E	1.145	1.00
74_W	77_N	1.133	1.00
8_L	85_V	1.131	1.00
21_A	25_R	1.125	1.00
112_L	116_S	1.111	1.00
4_N	83_D	1.102	1.00
36_Y	58_D	1.091	1.00
46_R	50_E	1.066	1.00
104_F	109_N	1.048	1.00
12_G	99_L	1.033	1.00
91_P	94_I	1.026	1.00
51_R	55_L	1.020	1.00
97_E	101_H	1.017	1.00
65_W	82_F	1.007	1.00
8_L	129_S	1.003	1.00
117_K	120_Q	1.002	1.00
129_S	132_D	0.998	1.00
118_Y	122_K	0.995	1.00
28_H	64_K	0.991	1.00
92_Q	129_S	0.984	1.00
116_S	120_Q	0.980	1.00
87_F	129_S	0.975	1.00
22_L	66_I	0.969	1.00
28_H	65_W	0.949	1.00
20_A	23_S	0.945	1.00
36_Y	40_D	0.944	1.00
99_L	128_A	0.940	1.00
5_I	84_L	0.928	1.00
104_F	108_G	0.920	1.00
96_L	111_V	0.912	1.00
100_R	103_E	0.912	1.00
113_A	118_Y	0.911	1.00
32_D	35_N	0.902	1.00
14_G	17_T	0.901	1.00
9_G	12_G	0.898	1.00
27_P	63_E	0.880	1.00
7_I	88_L	0.879	1.00
115_G	118_Y	0.877	1.00
103_E	106_R	0.872	1.00
4_N	65_W	0.858	1.00
6_H	82_F	0.857	1.00
23_S	66_I	0.854	1.00
127_W	132_D	0.849	1.00
113_A	119_E	0.848	1.00
124_F	127_W	0.846	1.00
103_E	108_G	0.846	1.00
23_S	29_T	0.846	1.00
39_L	50_E	0.846	1.00
16_S	68_S	0.839	1.00
49_P	53_K	0.838	1.00
9_G	13_V	0.836	1.00
127_W	130_L	0.835	1.00
46_R	51_R	0.827	1.00
36_Y	54_L	0.815	1.00
103_E	109_N	0.814	1.00
39_L	61_I	0.797	1.00
37_Y	45_K	0.788	1.00
23_S	26_L	0.779	0.99
117_K	121_S	0.773	0.99
113_A	120_Q	0.767	0.99
8_L	87_F	0.765	0.99
19_G	30_H	0.764	0.99
125_L	128_A	0.764	0.99
128_A	131_Y	0.757	0.99
40_D	53_K	0.753	0.99
92_Q	115_G	0.750	0.99
121_S	124_F	0.750	0.99
7_I	18_L	0.748	0.99
7_I	86_V	0.745	0.99
18_L	21_A	0.741	0.99
111_V	118_Y	0.738	0.99
7_I	66_I	0.724	0.99
56_E	77_N	0.720	0.99
39_L	46_R	0.720	0.99
81_Y	137_E	0.709	0.99
121_S	127_W	0.702	0.99
44_K	47_E	0.697	0.99
53_K	57_K	0.690	0.99
89_W	129_S	0.685	0.99
31_L	36_Y	0.685	0.99
127_W	131_Y	0.682	0.99
114_G	120_Q	0.681	0.99
115_G	119_E	0.678	0.99
11_S	127_W	0.673	0.98
35_N	39_L	0.664	0.98
93_D	115_G	0.662	0.98
16_S	30_H	0.662	0.98
110_E	114_G	0.661	0.98
33_T	55_L	0.661	0.98
58_D	64_K	0.660	0.98
57_K	60_T	0.659	0.98
111_V	114_G	0.657	0.98
37_Y	55_L	0.656	0.98
112_L	115_G	0.656	0.98
62_N	81_Y	0.652	0.98
112_L	119_E	0.648	0.98
18_L	98_R	0.645	0.98
17_T	98_R	0.636	0.98
112_L	117_K	0.636	0.98
13_V	88_L	0.635	0.98
52_R	73_G	0.632	0.98
4_N	81_Y	0.628	0.98
37_Y	46_R	0.627	0.98
24_K	27_P	0.627	0.98
132_D	136_M	0.625	0.98
133_N	136_M	0.620	0.97
131_Y	137_E	0.618	0.97
10_A	121_S	0.617	0.97
6_H	85_V	0.612	0.97
127_W	133_N	0.611	0.97
96_L	114_G	0.611	0.97
34_D	102_R	0.611	0.97
131_Y	134_A	0.605	0.97
36_Y	46_R	0.601	0.97
30_H	35_N	0.600	0.97
16_S	38_W	0.598	0.97
38_W	102_R	0.598	0.97
33_T	71_V	0.595	0.97
114_G	118_Y	0.594	0.97
33_T	67_L	0.593	0.97
29_T	64_K	0.592	0.97
129_S	133_N	0.585	0.96
100_R	108_G	0.582	0.96
45_K	51_R	0.581	0.96
121_S	128_A	0.580	0.96
15_T	68_S	0.580	0.96
104_F	107_Y	0.579	0.96
92_Q	132_D	0.579	0.96
103_E	107_Y	0.577	0.96
92_Q	96_L	0.566	0.96
52_R	55_L	0.563	0.96
7_I	23_S	0.560	0.95
100_R	110_E	0.559	0.95
17_T	68_S	0.553	0.95
114_G	117_K	0.553	0.95
128_A	134_A	0.548	0.95
99_L	103_E	0.545	0.95
96_L	129_S	0.544	0.95
5_I	82_F	0.541	0.94
132_D	135_G	0.538	0.94
29_T	80_S	0.535	0.94
28_H	58_D	0.529	0.94
37_Y	71_V	0.528	0.94
39_L	58_D	0.526	0.94
113_A	117_K	0.519	0.93
94_I	98_R	0.518	0.93
26_L	64_K	0.515	0.93
112_L	120_Q	0.504	0.92
14_G	98_R	0.502	0.92
134_A	137_E	0.501	0.92
40_D	58_D	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qbgB	1	0.9494	99.9	0.457	Contact Map
3gmtA	1	0.8483	99.9	0.466	Contact Map
2xb4A	4	0.9438	99.9	0.469	Contact Map
1zakA	2	1	99.9	0.472	Contact Map
3be4A	1	0.9438	99.9	0.475	Contact Map
1zd8A	1	0.9494	99.9	0.477	Contact Map
4pzlA	2	0.9663	99.9	0.478	Contact Map
1ak2A	1	0.9607	99.9	0.478	Contact Map
4jzkA	1	0.9438	99.9	0.478	Contact Map
4nu0A	1	0.9494	99.9	0.48	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.