YNEK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNEK - Uncharacterized protein YneK

UniProt:	P45711	Sequences: MLEGWFLWFILFWVIMMVVLLSIGGFFMFRKFLKRLPKEDGRSELDWQDYYIENSRHLWNDENKQFLDELTAPVPELFRDAAKAKIAGKIGELALKEKVAKIDQQLMIKGYILATPKRDHTFLKRHLRDKKIDLEPYQTLLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	142 (138)
Sequences:	165 (101)
Seq/√Len:	8.6

BACSU - YNEK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
68_D	83_K	3.834	0.97
16_M	20_L	3.551	0.96
45_L	48_Q	3.435	0.95
97_E	109_K	3.343	0.94
56_R	68_D	2.908	0.88
124_K	138_Q	2.797	0.86
56_R	83_K	2.772	0.85
6_F	10_I	2.565	0.80
52_I	84_A	2.479	0.78
69_E	130_K	2.455	0.77
124_K	141_L	2.428	0.76
4_G	7_L	2.352	0.74
89_K	92_E	2.345	0.74
45_L	49_D	2.012	0.61
99_V	106_L	1.966	0.59
9_F	17_M	1.947	0.59
12_F	16_M	1.917	0.57
50_Y	54_N	1.910	0.57
92_E	96_K	1.885	0.56
4_G	14_V	1.844	0.54
7_L	11_L	1.829	0.54
93_L	106_L	1.783	0.52
98_K	103_D	1.721	0.49
49_D	84_A	1.707	0.48
17_M	21_L	1.646	0.46
49_D	53_E	1.635	0.45
48_Q	52_I	1.629	0.45
10_I	13_W	1.625	0.45
97_E	106_L	1.580	0.43
15_I	55_S	1.510	0.40
52_I	139_T	1.459	0.38
105_Q	109_K	1.441	0.37
126_H	129_D	1.439	0.37
60_N	63_N	1.425	0.37
45_L	52_I	1.390	0.35
122_F	125_R	1.386	0.35
35_R	39_E	1.373	0.35
11_L	15_I	1.369	0.35
14_V	17_M	1.349	0.34
5_W	8_W	1.339	0.33
131_K	138_Q	1.300	0.32
19_V	22_S	1.300	0.32
18_V	21_L	1.277	0.31
7_L	14_V	1.262	0.31
6_F	13_W	1.231	0.29
49_D	52_I	1.205	0.29
45_L	84_A	1.200	0.28
42_R	61_D	1.157	0.27
69_E	77_L	1.142	0.26
61_D	65_Q	1.137	0.26
20_L	100_A	1.136	0.26
122_F	141_L	1.133	0.26
48_Q	84_A	1.120	0.26
105_Q	129_D	1.105	0.25
26_F	124_K	1.104	0.25
11_L	14_V	1.085	0.25
125_R	141_L	1.071	0.24
51_Y	95_L	1.069	0.24
36_L	39_E	1.055	0.24
81_A	120_H	1.041	0.23
104_Q	130_K	1.035	0.23
10_I	14_V	1.031	0.23
50_Y	53_E	1.011	0.22
55_S	121_T	1.008	0.22
7_L	21_L	0.983	0.21
35_R	77_L	0.977	0.21
22_S	135_E	0.975	0.21
44_E	55_S	0.966	0.21
84_A	126_H	0.954	0.21
7_L	101_K	0.945	0.20
53_E	56_R	0.927	0.20
44_E	48_Q	0.926	0.20
60_N	96_K	0.920	0.20
7_L	26_F	0.918	0.20
19_V	23_I	0.917	0.20
55_S	91_G	0.906	0.19
26_F	139_T	0.902	0.19
93_L	97_E	0.891	0.19
50_Y	131_K	0.890	0.19
63_N	102_I	0.884	0.19
84_A	139_T	0.874	0.19
42_R	138_Q	0.870	0.18
21_L	126_H	0.867	0.18
39_E	51_Y	0.866	0.18
91_G	123_L	0.865	0.18
45_L	83_K	0.855	0.18
69_E	107_M	0.844	0.18
35_R	106_L	0.837	0.18
99_V	109_K	0.834	0.18
8_W	97_E	0.825	0.17
58_L	97_E	0.825	0.17
4_G	11_L	0.822	0.17
104_Q	139_T	0.816	0.17
35_R	45_L	0.812	0.17
124_K	134_L	0.810	0.17
65_Q	135_E	0.807	0.17
100_A	103_D	0.800	0.17
69_E	126_H	0.800	0.17
54_N	100_A	0.795	0.17
6_F	105_Q	0.793	0.17
26_F	62_E	0.793	0.17
54_N	108_I	0.779	0.16
14_V	138_Q	0.778	0.16
108_I	123_L	0.773	0.16
56_R	84_A	0.758	0.16
6_F	14_V	0.756	0.16
108_I	131_K	0.753	0.16
16_M	105_Q	0.752	0.16
126_H	134_L	0.748	0.16
35_R	52_I	0.742	0.15
55_S	106_L	0.740	0.15
126_H	130_K	0.737	0.15
106_L	109_K	0.736	0.15
57_H	91_G	0.734	0.15
22_S	26_F	0.727	0.15
72_A	126_H	0.721	0.15
4_G	22_S	0.721	0.15
26_F	44_E	0.720	0.15
97_E	117_K	0.714	0.15
72_A	131_K	0.708	0.15
74_V	82_A	0.704	0.15
89_K	106_L	0.699	0.14
57_H	95_L	0.696	0.14
58_L	117_K	0.694	0.14
8_W	57_H	0.689	0.14
33_L	120_H	0.686	0.14
53_E	81_A	0.686	0.14
17_M	93_L	0.685	0.14
33_L	38_K	0.678	0.14
35_R	44_E	0.677	0.14
54_N	81_A	0.670	0.14
19_V	62_E	0.670	0.14
12_F	19_V	0.667	0.14
5_W	122_F	0.667	0.14
109_K	113_L	0.667	0.14
95_L	102_I	0.662	0.14
36_L	84_A	0.660	0.14
129_D	134_L	0.655	0.14
80_D	109_K	0.653	0.14
12_F	68_D	0.652	0.13
62_E	132_I	0.648	0.13
76_E	125_R	0.645	0.13
11_L	50_Y	0.644	0.13
35_R	140_L	0.637	0.13
95_L	130_K	0.637	0.13
51_Y	97_E	0.636	0.13
19_V	131_K	0.636	0.13
102_I	140_L	0.631	0.13
89_K	124_K	0.631	0.13
58_L	109_K	0.630	0.13
93_L	113_L	0.626	0.13
84_A	100_A	0.622	0.13
76_E	85_K	0.622	0.13
101_K	104_Q	0.622	0.13
11_L	26_F	0.620	0.13
4_G	44_E	0.618	0.13
102_I	107_M	0.617	0.13
9_F	100_A	0.615	0.13
49_D	139_T	0.615	0.13
66_F	81_A	0.608	0.13
11_L	21_L	0.608	0.13
50_Y	65_Q	0.608	0.13
125_R	129_D	0.603	0.13
42_R	89_K	0.599	0.12
15_I	107_M	0.596	0.12
55_S	108_I	0.590	0.12
64_K	84_A	0.587	0.12
22_S	138_Q	0.585	0.12
20_L	131_K	0.585	0.12
81_A	98_K	0.579	0.12
24_G	27_F	0.578	0.12
45_L	99_V	0.577	0.12
69_E	120_H	0.576	0.12
35_R	49_D	0.574	0.12
7_L	58_L	0.573	0.12
8_W	11_L	0.573	0.12
55_S	102_I	0.571	0.12
4_G	122_F	0.569	0.12
16_M	53_E	0.567	0.12
17_M	81_A	0.566	0.12
52_I	140_L	0.563	0.12
64_K	68_D	0.562	0.12
48_Q	85_K	0.561	0.12
63_N	134_L	0.557	0.12
77_L	120_H	0.552	0.12
77_L	126_H	0.550	0.12
76_E	122_F	0.546	0.12
99_V	104_Q	0.539	0.11
9_F	15_I	0.532	0.11
16_M	19_V	0.531	0.11
60_N	134_L	0.529	0.11
6_F	9_F	0.528	0.11
81_A	131_K	0.527	0.11
8_W	22_S	0.522	0.11
26_F	61_D	0.521	0.11
20_L	72_A	0.521	0.11
39_E	49_D	0.521	0.11
64_K	83_K	0.519	0.11
56_R	107_M	0.517	0.11
26_F	122_F	0.517	0.11
4_G	21_L	0.516	0.11
68_D	109_K	0.515	0.11
63_N	88_G	0.509	0.11
26_F	65_Q	0.509	0.11
15_I	54_N	0.508	0.11
38_K	121_T	0.504	0.11
101_K	131_K	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pc9A	1	0.6972	29.8	0.96	Contact Map
2kruA	1	0.4437	13.3	0.966	Contact Map
2l09A	1	0.4366	10.5	0.967	Contact Map
4pf6A	1	0.7183	9.8	0.968	Contact Map
2xwvA	1	0.7676	9.8	0.968	Contact Map
1fexA	1	0.3521	9.6	0.968	Contact Map
4uybA	1	0.4014	9.5	0.968	Contact Map
4m8oA	1	0.5986	8.8	0.968	Contact Map
2eqrA	1	0.4296	8.6	0.969	Contact Map
1d4oA	1	0.3873	8.6	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0087 seconds.