CCDC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CCDC - Protein CcdC

UniProt:	P45710	Sequences: MMIIVSSIIAVLMAVAVMVVRIKSSDKPVSPKKIILPPIFMSTGALMFLFPVFWVTGAEFLEAFTLGVIFSIFLIKTSKFEIKNNEIYMKRSKAFVFILVGLLVIRIVMKSILSTSIDYGALSGMFWILAFGMIVPWRIAMYLSYRKLHNELQSSNIQMN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (149)
Sequences:	256 (191)
Seq/√Len:	15.6

BACSU - CCDC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_L	40_F	6.703	1.00
64_F	132_G	5.510	1.00
56_T	59_E	3.834	1.00
78_S	89_M	3.704	1.00
97_F	101_G	3.505	0.99
29_V	145_Y	3.049	0.98
48_F	55_V	2.962	0.98
118_D	122_L	2.615	0.96
15_V	100_V	2.421	0.93
91_R	136_P	2.413	0.93
69_I	73_F	2.210	0.90
48_F	128_I	2.122	0.87
9_I	16_A	2.023	0.85
79_K	144_S	1.966	0.83
23_K	27_K	1.960	0.83
14_A	122_L	1.839	0.79
62_E	125_M	1.770	0.76
45_A	53_F	1.707	0.73
18_M	104_V	1.658	0.71
54_W	145_Y	1.652	0.70
35_I	142_Y	1.593	0.68
15_V	112_I	1.569	0.66
88_Y	105_I	1.550	0.65
45_A	120_G	1.537	0.65
11_V	64_F	1.504	0.63
40_F	59_E	1.494	0.62
48_F	132_G	1.462	0.61
73_F	76_K	1.447	0.60
50_F	120_G	1.442	0.60
63_A	66_L	1.427	0.59
60_F	125_M	1.390	0.57
57_G	60_F	1.390	0.57
89_M	140_A	1.371	0.56
42_S	131_F	1.334	0.54
11_V	151_E	1.320	0.53
9_I	17_V	1.317	0.53
14_A	73_F	1.312	0.52
27_K	33_K	1.304	0.52
57_G	65_T	1.266	0.50
107_I	144_S	1.223	0.47
61_L	85_N	1.222	0.47
17_V	91_R	1.209	0.46
109_M	115_T	1.209	0.46
84_N	104_V	1.185	0.45
29_V	78_S	1.179	0.45
40_F	110_K	1.177	0.45
64_F	135_V	1.156	0.43
75_I	140_A	1.155	0.43
53_F	120_G	1.151	0.43
96_V	100_V	1.149	0.43
17_V	20_V	1.136	0.42
9_I	12_L	1.085	0.39
95_F	134_I	1.079	0.39
9_I	20_V	1.069	0.39
47_M	102_L	1.063	0.38
102_L	141_M	1.061	0.38
55_V	128_I	1.050	0.38
145_Y	148_L	1.045	0.37
94_A	98_I	1.036	0.37
50_F	53_F	1.029	0.36
72_I	76_K	1.025	0.36
38_P	141_M	1.024	0.36
59_E	121_A	1.023	0.36
49_L	60_F	1.017	0.36
107_I	145_Y	1.008	0.35
48_F	127_W	1.002	0.35
56_T	76_K	1.001	0.35
13_M	99_L	1.000	0.35
36_L	117_I	0.982	0.34
5_V	11_V	0.981	0.34
42_S	46_L	0.978	0.34
16_A	107_I	0.976	0.34
38_P	41_M	0.975	0.34
59_E	73_F	0.973	0.33
49_L	52_V	0.964	0.33
60_F	64_F	0.963	0.33
60_F	128_I	0.960	0.33
65_T	119_Y	0.957	0.33
55_V	120_G	0.952	0.32
133_M	141_M	0.945	0.32
7_S	11_V	0.925	0.31
13_M	81_E	0.914	0.31
65_T	68_V	0.914	0.31
78_S	92_S	0.913	0.30
25_S	89_M	0.912	0.30
58_A	112_I	0.890	0.29
14_A	99_L	0.882	0.29
58_A	68_V	0.880	0.29
47_M	129_L	0.874	0.29
55_V	60_F	0.874	0.29
59_E	142_Y	0.872	0.29
6_S	93_K	0.865	0.28
146_R	150_N	0.862	0.28
29_V	89_M	0.857	0.28
38_P	133_M	0.854	0.28
108_V	112_I	0.846	0.27
62_E	120_G	0.845	0.27
96_V	150_N	0.839	0.27
8_I	112_I	0.837	0.27
143_L	146_R	0.833	0.27
32_K	48_F	0.828	0.27
84_N	88_Y	0.827	0.26
31_P	89_M	0.818	0.26
49_L	65_T	0.815	0.26
10_A	13_M	0.810	0.26
40_F	117_I	0.809	0.26
60_F	118_D	0.799	0.25
36_L	81_E	0.798	0.25
18_M	109_M	0.796	0.25
66_L	109_M	0.793	0.25
122_L	132_G	0.792	0.25
73_F	110_K	0.784	0.25
48_F	60_F	0.777	0.24
55_V	127_W	0.775	0.24
52_V	120_G	0.773	0.24
114_S	122_L	0.772	0.24
73_F	121_A	0.771	0.24
41_M	141_M	0.770	0.24
118_D	127_W	0.766	0.24
114_S	127_W	0.762	0.24
68_V	91_R	0.761	0.24
21_R	95_F	0.758	0.24
65_T	84_N	0.757	0.23
83_K	111_S	0.756	0.23
54_W	116_S	0.753	0.23
13_M	133_M	0.749	0.23
18_M	103_L	0.745	0.23
30_S	147_K	0.743	0.23
13_M	117_I	0.739	0.23
11_V	113_L	0.738	0.23
110_K	124_G	0.734	0.23
69_I	104_V	0.731	0.22
36_L	39_I	0.719	0.22
22_I	127_W	0.712	0.22
88_Y	109_M	0.710	0.22
104_V	121_A	0.709	0.22
112_I	143_L	0.708	0.22
4_I	145_Y	0.701	0.21
35_I	117_I	0.697	0.21
39_I	42_S	0.691	0.21
38_P	92_S	0.690	0.21
12_L	143_L	0.690	0.21
8_I	15_V	0.688	0.21
65_T	86_E	0.687	0.21
38_P	47_M	0.686	0.21
70_F	142_Y	0.685	0.21
31_P	84_N	0.684	0.21
71_S	75_I	0.678	0.20
17_V	115_T	0.677	0.20
18_M	96_V	0.676	0.20
80_F	89_M	0.674	0.20
113_L	128_I	0.672	0.20
19_V	66_L	0.671	0.20
55_V	124_G	0.671	0.20
20_V	128_I	0.664	0.20
31_P	142_Y	0.659	0.20
131_F	135_V	0.658	0.20
25_S	121_A	0.654	0.20
55_V	104_V	0.646	0.19
60_F	73_F	0.645	0.19
41_M	133_M	0.644	0.19
136_P	140_A	0.644	0.19
7_S	10_A	0.642	0.19
38_P	102_L	0.637	0.19
16_A	113_L	0.635	0.19
52_V	127_W	0.635	0.19
22_I	88_Y	0.634	0.19
105_I	109_M	0.633	0.19
10_A	62_E	0.632	0.19
35_I	65_T	0.623	0.18
122_L	125_M	0.622	0.18
145_Y	149_H	0.622	0.18
6_S	148_L	0.617	0.18
25_S	96_V	0.616	0.18
11_V	104_V	0.611	0.18
73_F	125_M	0.609	0.18
41_M	102_L	0.604	0.18
41_M	47_M	0.604	0.18
36_L	57_G	0.603	0.18
35_I	145_Y	0.600	0.18
4_I	29_V	0.599	0.18
89_M	123_S	0.599	0.18
26_D	144_S	0.598	0.18
55_V	119_Y	0.595	0.17
39_I	61_L	0.590	0.17
32_K	39_I	0.582	0.17
15_V	119_Y	0.580	0.17
48_F	141_M	0.577	0.17
93_K	145_Y	0.575	0.17
35_I	82_I	0.574	0.17
4_I	149_H	0.574	0.17
135_V	142_Y	0.570	0.17
45_A	123_S	0.566	0.17
72_I	101_G	0.563	0.16
22_I	91_R	0.561	0.16
17_V	136_P	0.561	0.16
48_F	63_A	0.560	0.16
75_I	78_S	0.559	0.16
18_M	113_L	0.557	0.16
27_K	58_A	0.556	0.16
110_K	114_S	0.550	0.16
11_V	16_A	0.549	0.16
11_V	86_E	0.546	0.16
45_A	114_S	0.545	0.16
26_D	82_I	0.544	0.16
26_D	86_E	0.543	0.16
43_T	47_M	0.534	0.16
45_A	131_F	0.534	0.16
12_L	61_L	0.532	0.15
47_M	141_M	0.530	0.15
4_I	139_I	0.528	0.15
85_N	151_E	0.527	0.15
111_S	140_A	0.525	0.15
60_F	121_A	0.524	0.15
55_V	107_I	0.518	0.15
26_D	134_I	0.516	0.15
45_A	64_F	0.516	0.15
66_L	97_F	0.513	0.15
85_N	105_I	0.513	0.15
92_S	141_M	0.512	0.15
16_A	58_A	0.510	0.15
110_K	120_G	0.508	0.15
105_I	145_Y	0.505	0.15
102_L	126_F	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xnjA	1	0.875	34.3	0.948	Contact Map
1pi7A	1	0.1125	10.8	0.959	Contact Map
4ikvA	1	0.9062	10.3	0.959	Contact Map
4j05A	3	0.9187	8.7	0.961	Contact Map
4bwzA	2	0.875	8.2	0.961	Contact Map
4w6vA	1	0.8562	5.7	0.964	Contact Map
4tphA	2	0.7562	5.4	0.964	Contact Map
3wdoA	1	0.95	5.1	0.965	Contact Map
5a2fA	1	0	5	0.965	Contact Map
4uvmA	1	0.9125	4.6	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.