SP5S - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP5S - Stage V sporulation protein S

UniProt:	P45693	Sequences: MEILKVSAKSSPNSVAGALAGVLRERGAAEIQAIGAGALNQAVKAVAIARGFVAPSGVDLICIPAFTDIQIDGEERTAIKLIVEPR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	86 (83)
Sequences:	235 (113)
Seq/√Len:	12.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_V	81_L	3.919	0.99
51_G	55_P	3.663	0.99
39_L	81_L	3.585	0.99
10_S	15_V	3.548	0.99
40_N	44_K	2.161	0.81
53_V	60_L	2.064	0.78
13_N	46_V	1.975	0.75
4_L	12_P	1.853	0.70
61_I	84_E	1.744	0.65
39_L	46_V	1.736	0.65
24_R	52_F	1.732	0.64
19_L	29_A	1.672	0.62
31_I	52_F	1.491	0.53
44_K	48_I	1.423	0.49
41_Q	44_K	1.391	0.47
23_L	69_I	1.389	0.47
34_I	68_D	1.382	0.47
2_E	75_E	1.359	0.46
40_N	48_I	1.347	0.45
46_V	81_L	1.343	0.45
45_A	52_F	1.339	0.45
6_V	10_S	1.311	0.43
46_V	62_C	1.306	0.43
3_I	9_K	1.275	0.42
37_G	41_Q	1.231	0.39
34_I	67_T	1.211	0.39
51_G	54_A	1.194	0.38
17_G	20_A	1.157	0.36
5_K	44_K	1.156	0.36
45_A	79_I	1.147	0.35
65_A	80_K	1.138	0.35
60_L	65_A	1.131	0.35
23_L	75_E	1.130	0.35
11_S	56_S	1.124	0.34
67_T	80_K	1.115	0.34
40_N	47_A	1.092	0.33
10_S	18_A	1.083	0.33
65_A	82_I	1.041	0.31
37_G	79_I	1.038	0.31
35_G	64_P	1.026	0.30
2_E	84_E	1.023	0.30
21_G	38_A	1.017	0.30
5_K	40_N	0.999	0.29
19_L	26_R	0.996	0.29
11_S	52_F	0.996	0.29
68_D	78_A	0.973	0.28
36_A	57_G	0.969	0.28
39_L	60_L	0.963	0.27
12_P	18_A	0.944	0.27
19_L	68_D	0.942	0.27
32_Q	41_Q	0.931	0.26
13_N	21_G	0.931	0.26
4_L	43_V	0.915	0.26
58_V	78_A	0.883	0.24
22_V	34_I	0.880	0.24
28_A	84_E	0.878	0.24
62_C	68_D	0.877	0.24
30_E	33_A	0.857	0.23
3_I	82_I	0.854	0.23
39_L	67_T	0.854	0.23
14_S	58_V	0.850	0.23
44_K	47_A	0.817	0.22
17_G	52_F	0.800	0.21
54_A	60_L	0.775	0.20
19_L	53_V	0.767	0.20
13_N	81_L	0.763	0.20
5_K	9_K	0.762	0.20
73_G	84_E	0.761	0.20
46_V	55_P	0.755	0.20
2_E	53_V	0.735	0.19
49_A	81_L	0.733	0.19
4_L	18_A	0.730	0.19
49_A	53_V	0.730	0.19
32_Q	59_D	0.729	0.19
14_S	52_F	0.728	0.19
25_E	52_F	0.725	0.19
6_V	31_I	0.714	0.19
51_G	78_A	0.711	0.18
20_A	56_S	0.706	0.18
26_R	74_E	0.706	0.18
33_A	43_V	0.694	0.18
24_R	78_A	0.687	0.18
2_E	63_I	0.686	0.18
23_L	53_V	0.686	0.18
41_Q	48_I	0.685	0.18
19_L	31_I	0.683	0.18
8_A	28_A	0.677	0.17
36_A	63_I	0.677	0.17
8_A	14_S	0.667	0.17
62_C	81_L	0.667	0.17
9_K	43_V	0.660	0.17
2_E	81_L	0.655	0.17
4_L	39_L	0.653	0.17
39_L	53_V	0.643	0.16
12_P	17_G	0.625	0.16
33_A	39_L	0.621	0.16
71_I	79_I	0.619	0.16
31_I	84_E	0.616	0.16
73_G	83_V	0.607	0.15
16_A	66_F	0.603	0.15
59_D	64_P	0.597	0.15
33_A	81_L	0.597	0.15
56_S	62_C	0.595	0.15
13_N	47_A	0.592	0.15
2_E	50_R	0.590	0.15
32_Q	44_K	0.590	0.15
28_A	82_I	0.586	0.15
9_K	52_F	0.579	0.15
32_Q	40_N	0.566	0.14
62_C	72_D	0.556	0.14
52_F	79_I	0.553	0.14
34_I	42_A	0.548	0.14
5_K	41_Q	0.547	0.14
33_A	76_R	0.545	0.14
54_A	62_C	0.545	0.14
34_I	71_I	0.532	0.14
22_V	80_K	0.528	0.13
46_V	49_A	0.513	0.13
13_N	23_L	0.512	0.13
27_G	56_S	0.508	0.13
50_R	59_D	0.506	0.13
33_A	67_T	0.501	0.13
72_D	80_K	0.501	0.13
23_L	58_V	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ek0A	3	1	100	0.046	Contact Map
1jq5A	5	0.9186	34.2	0.91	Contact Map
4mcaA	7	0.9186	33.4	0.91	Contact Map
3uhjA	5	0.9186	32.2	0.911	Contact Map
1ta9A	5	0.907	24	0.917	Contact Map
1kq3A	5	0.907	23.6	0.917	Contact Map
4fr2A	2	0.9651	21.7	0.918	Contact Map
3ce9A	3	0.8837	20.6	0.919	Contact Map
3w5sA	2	0.8837	20.3	0.919	Contact Map
3iv7A	2	0.8721	16.8	0.922	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.