LIPC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

LIPC - Spore germination lipase LipC

UniProt:	P42969	Sequences: MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINIFARSGLNTEEILGLLSYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVSAHCHENFEKMIAKVAEIKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASAPHVKIADAYSIFKGKEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	213 (194)
Sequences:	2453 (1875)
Seq/√Len:	134.6

ECOLI - TESA
BACSU - LIPC YPMR YQEF
SULSO - Q97UG8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
135_N	168_I	4.881	1.00
5_Y	76_T	3.473	1.00
130_A	167_K	3.303	1.00
132_R	169_A	2.863	1.00
117_K	120_E	2.680	1.00
134_F	202_V	2.613	1.00
56_I	79_G	2.500	1.00
93_T	96_D	2.265	1.00
7_A	26_V	2.236	1.00
15_G	18_S	2.226	1.00
131_I	166_V	2.196	1.00
151_T	172_Y	2.190	1.00
154_N	172_Y	2.172	1.00
117_K	121_I	2.150	1.00
46_F	67_K	2.136	1.00
158_E	162_S	2.120	1.00
13_T	47_A	2.098	1.00
14_T	49_S	2.097	1.00
16_R	49_S	1.959	1.00
92_Q	96_D	1.952	1.00
56_I	114_M	1.884	1.00
112_E	160_L	1.873	1.00
13_T	78_T	1.867	1.00
28_R	196_Q	1.867	1.00
101_S	152_S	1.829	1.00
75_I	129_Y	1.799	1.00
195_Y	198_M	1.774	1.00
57_L	117_K	1.757	1.00
25_F	29_F	1.753	1.00
53_T	114_M	1.719	1.00
135_N	170_D	1.716	1.00
69_I	72_A	1.709	1.00
29_F	203_H	1.695	1.00
115_I	133_V	1.692	1.00
74_M	132_R	1.692	1.00
69_I	122_K	1.674	1.00
133_V	157_L	1.662	1.00
61_S	117_K	1.647	1.00
181_E	184_S	1.638	1.00
170_D	173_S	1.614	1.00
122_K	129_Y	1.574	1.00
150_I	154_N	1.560	1.00
12_L	137_Y	1.558	1.00
6_T	72_A	1.557	1.00
115_I	166_V	1.554	1.00
51_L	55_E	1.516	1.00
93_T	100_F	1.492	1.00
16_R	195_Y	1.484	1.00
155_S	158_E	1.462	1.00
24_G	45_I	1.447	1.00
29_F	202_V	1.425	1.00
112_E	116_A	1.424	1.00
32_M	203_H	1.421	1.00
25_F	28_R	1.416	1.00
88_V	91_Y	1.405	1.00
154_N	157_L	1.393	1.00
79_G	114_M	1.359	1.00
83_D	110_N	1.335	1.00
196_Q	200_E	1.328	1.00
160_L	163_A	1.324	1.00
133_V	161_A	1.323	1.00
96_D	100_F	1.319	1.00
7_A	76_T	1.308	1.00
23_P	31_D	1.303	1.00
65_V	68_C	1.301	1.00
111_F	157_L	1.275	1.00
56_I	65_V	1.269	1.00
8_L	46_F	1.268	1.00
52_N	55_E	1.261	1.00
7_A	13_T	1.245	1.00
147_G	151_T	1.238	1.00
48_R	51_L	1.215	1.00
85_I	91_Y	1.191	0.99
18_S	195_Y	1.182	0.99
24_G	195_Y	1.181	0.99
28_R	32_M	1.173	0.99
136_L	153_F	1.173	0.99
108_H	159_T	1.157	0.99
108_H	112_E	1.138	0.99
78_T	81_G	1.123	0.99
155_S	159_T	1.111	0.99
46_F	68_C	1.109	0.99
17_G	188_V	1.107	0.99
85_I	88_V	1.103	0.99
123_G	129_Y	1.101	0.99
26_V	43_I	1.095	0.99
115_I	131_I	1.084	0.99
27_Q	31_D	1.070	0.99
192_S	196_Q	1.066	0.99
148_K	152_S	1.059	0.99
92_Q	97_E	1.052	0.99
132_R	167_K	1.050	0.99
171_A	198_M	1.035	0.99
12_L	139_P	1.031	0.99
87_S	91_Y	1.026	0.98
53_T	110_N	1.017	0.98
174_I	201_A	1.017	0.98
23_P	26_V	1.002	0.98
57_L	65_V	0.996	0.98
29_F	32_M	0.990	0.98
12_L	190_P	0.987	0.98
55_E	59_L	0.974	0.98
99_I	102_R	0.967	0.98
121_I	124_E	0.960	0.98
134_F	198_M	0.955	0.98
161_A	165_H	0.950	0.97
15_G	195_Y	0.948	0.97
116_A	164_P	0.943	0.97
180_Q	184_S	0.935	0.97
66_Q	121_I	0.931	0.97
113_K	116_A	0.928	0.97
175_F	194_G	0.925	0.97
47_A	59_L	0.925	0.97
143_I	147_G	0.921	0.97
53_T	60_L	0.921	0.97
139_P	150_I	0.908	0.97
99_I	103_V	0.900	0.97
152_S	156_H	0.896	0.96
79_G	82_N	0.894	0.96
199_A	203_H	0.891	0.96
28_R	31_D	0.886	0.96
169_A	202_V	0.880	0.96
32_M	200_E	0.875	0.96
8_L	60_L	0.875	0.96
24_G	27_Q	0.871	0.96
190_P	198_M	0.869	0.96
193_K	196_Q	0.865	0.96
142_E	145_I	0.859	0.95
57_L	113_K	0.846	0.95
64_Y	68_C	0.844	0.95
5_Y	74_M	0.843	0.95
196_Q	204_K	0.839	0.95
24_G	47_A	0.837	0.95
105_A	108_H	0.835	0.95
51_L	59_L	0.832	0.95
107_C	115_I	0.826	0.94
112_E	163_A	0.824	0.94
133_V	166_V	0.822	0.94
101_S	106_H	0.821	0.94
12_L	195_Y	0.820	0.94
6_T	65_V	0.816	0.94
60_L	65_V	0.816	0.94
106_H	110_N	0.814	0.94
157_L	168_I	0.810	0.94
30_G	34_E	0.809	0.94
13_T	134_F	0.807	0.94
107_C	111_F	0.803	0.94
78_T	134_F	0.801	0.93
135_N	154_N	0.799	0.93
25_F	30_G	0.790	0.93
57_L	114_M	0.789	0.93
138_N	175_F	0.786	0.93
173_S	201_A	0.781	0.93
180_Q	183_L	0.779	0.92
28_R	199_A	0.778	0.92
26_V	32_M	0.775	0.92
68_C	72_A	0.768	0.92
137_Y	198_M	0.762	0.92
12_L	136_L	0.756	0.91
115_I	168_I	0.754	0.91
160_L	164_P	0.753	0.91
46_F	65_V	0.750	0.91
21_F	49_S	0.750	0.91
98_T	102_R	0.749	0.91
138_N	147_G	0.749	0.91
51_L	56_I	0.748	0.91
112_E	164_P	0.748	0.91
97_E	146_A	0.746	0.91
54_E	110_N	0.742	0.91
10_D	154_N	0.742	0.91
55_E	86_D	0.736	0.90
65_V	117_K	0.733	0.90
10_D	13_T	0.729	0.90
81_G	136_L	0.721	0.89
108_H	156_H	0.715	0.89
189_H	194_G	0.709	0.88
82_N	189_H	0.707	0.88
153_F	157_L	0.703	0.88
88_V	188_V	0.703	0.88
69_I	121_I	0.701	0.88
156_H	160_L	0.701	0.88
31_D	71_D	0.697	0.88
118_V	187_G	0.696	0.88
109_E	113_K	0.692	0.87
118_V	131_I	0.692	0.87
77_I	118_V	0.689	0.87
198_M	201_A	0.684	0.87
197_A	201_A	0.683	0.87
29_F	199_A	0.678	0.86
10_D	168_I	0.676	0.86
19_G	192_S	0.675	0.86
22_S	26_V	0.672	0.86
76_T	202_V	0.672	0.86
119_A	131_I	0.668	0.85
48_R	72_A	0.667	0.85
105_A	152_S	0.661	0.85
191_N	194_G	0.655	0.84
64_Y	67_K	0.653	0.84
46_F	69_I	0.652	0.84
14_T	45_I	0.649	0.84
100_F	103_V	0.648	0.84
24_G	140_F	0.646	0.83
96_D	99_I	0.643	0.83
94_S	98_T	0.641	0.83
45_I	48_R	0.641	0.83
137_Y	168_I	0.638	0.83
98_T	101_S	0.634	0.82
48_R	91_Y	0.631	0.82
183_L	187_G	0.630	0.82
169_A	201_A	0.630	0.82
14_T	21_F	0.629	0.82
12_L	138_N	0.625	0.81
48_R	55_E	0.621	0.81
11_S	189_H	0.617	0.81
193_K	197_A	0.617	0.81
130_A	159_T	0.615	0.80
95_K	182_Y	0.611	0.80
16_R	19_G	0.610	0.80
66_Q	98_T	0.608	0.80
25_F	32_M	0.606	0.79
5_Y	30_G	0.605	0.79
13_T	26_V	0.604	0.79
143_I	150_I	0.600	0.79
56_I	59_L	0.599	0.79
84_L	103_V	0.599	0.79
25_F	47_A	0.592	0.78
106_H	155_S	0.591	0.78
17_G	81_G	0.591	0.78
102_R	144_D	0.590	0.78
120_E	148_K	0.587	0.77
156_H	159_T	0.586	0.77
144_D	156_H	0.585	0.77
50_G	53_T	0.585	0.77
123_G	130_A	0.585	0.77
91_Y	135_N	0.582	0.77
97_E	101_S	0.581	0.76
23_P	29_F	0.580	0.76
33_M	36_D	0.580	0.76
114_M	117_K	0.578	0.76
151_T	155_S	0.574	0.76
53_T	111_F	0.574	0.76
197_A	200_E	0.573	0.75
15_G	191_N	0.572	0.75
109_E	112_E	0.571	0.75
111_F	160_L	0.567	0.75
118_V	129_Y	0.565	0.74
85_I	89_L	0.565	0.74
81_G	190_P	0.559	0.74
117_K	148_K	0.557	0.73
112_E	166_V	0.557	0.73
49_S	136_L	0.555	0.73
93_T	97_E	0.554	0.73
175_F	178_K	0.554	0.73
134_F	157_L	0.554	0.73
105_A	109_E	0.552	0.73
18_S	192_S	0.551	0.73
34_E	124_E	0.550	0.72
6_T	75_I	0.549	0.72
12_L	175_F	0.547	0.72
130_A	134_F	0.546	0.72
190_P	194_G	0.546	0.72
94_S	99_I	0.543	0.72
78_T	140_F	0.543	0.72
107_C	153_F	0.541	0.71
111_F	115_I	0.540	0.71
14_T	81_G	0.540	0.71
10_D	135_N	0.537	0.71
16_R	47_A	0.534	0.70
35_A	73_D	0.533	0.70
63_P	66_Q	0.532	0.70
104_S	141_P	0.532	0.70
25_F	33_M	0.528	0.69
73_D	124_E	0.527	0.69
73_D	77_I	0.527	0.69
26_V	30_G	0.525	0.69
138_N	195_Y	0.523	0.69
24_G	28_R	0.521	0.68
173_S	176_K	0.519	0.68
78_T	190_P	0.519	0.68
50_G	82_N	0.517	0.68
99_I	105_A	0.511	0.67
124_E	173_S	0.510	0.67
113_K	124_E	0.508	0.66
147_G	172_Y	0.506	0.66
12_L	198_M	0.506	0.66
141_P	144_D	0.504	0.66
57_L	61_S	0.503	0.66
19_G	23_P	0.502	0.66
78_T	150_I	0.501	0.65
174_I	197_A	0.501	0.65
192_S	200_E	0.500	0.65

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1escA	1	0.9671	100	0.389	Contact Map
4hyqA	1	0.9108	100	0.39	Contact Map
3bzwA	4	0.9484	100	0.487	Contact Map
4q9aA	2	0.9108	100	0.499	Contact Map
4jhlA	5	0.939	99.9	0.504	Contact Map
3dc7A	3	0.9155	99.9	0.505	Contact Map
1vjgA	2	0.8967	99.9	0.512	Contact Map
3hp4A	1	0.8545	99.9	0.512	Contact Map
4devA	5	0.9108	99.9	0.513	Contact Map
4m8kA	2	0.8638	99.9	0.519	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.