YSLB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YSLB - Uncharacterized protein YslB

UniProt:	P42955	Sequences: MKSKFEASIDNLKEIEMNAYAYELIREIVLPDMLGQDYSSMMYWAGKHLARKFPLESWEEFPAFFEEAGWGTLTNVSAKKQELEFELEGPIISNRLKHQKEPCFQLEAGFIAEQIQLMNDQIAESYEQVKKRADKVVLTVKWDMKDPV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	148 (132)
Sequences:	248 (199)
Seq/√Len:	17.3

BACSU - YSLB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_Y	68_A	4.655	1.00
113_E	116_Q	4.413	1.00
89_G	92_I	3.499	1.00
64_F	68_A	3.186	0.99
125_S	138_L	3.010	0.99
62_P	138_L	2.721	0.97
54_P	114_Q	2.342	0.94
25_I	33_M	2.169	0.91
29_V	33_M	2.083	0.89
29_V	45_A	2.040	0.88
32_D	48_H	2.009	0.87
21_A	25_I	1.887	0.84
81_Q	123_A	1.865	0.83
29_V	44_W	1.864	0.83
108_A	138_L	1.811	0.81
66_E	72_T	1.761	0.79
19_A	92_I	1.760	0.79
104_F	136_V	1.753	0.79
28_I	53_F	1.733	0.78
24_L	64_F	1.691	0.76
92_I	104_F	1.658	0.75
61_F	115_I	1.626	0.73
60_E	67_E	1.590	0.72
18_N	69_G	1.567	0.71
57_S	136_V	1.462	0.65
55_L	118_M	1.454	0.65
31_P	95_R	1.451	0.64
92_I	95_R	1.442	0.64
58_W	75_N	1.396	0.61
105_Q	127_E	1.361	0.59
57_S	60_E	1.352	0.59
53_F	67_E	1.351	0.59
97_K	134_D	1.344	0.58
19_A	23_E	1.335	0.58
28_I	37_D	1.321	0.57
126_Y	141_K	1.293	0.55
20_Y	114_Q	1.260	0.53
56_E	82_E	1.245	0.52
81_Q	144_M	1.233	0.52
49_L	110_F	1.222	0.51
22_Y	25_I	1.218	0.51
31_P	124_E	1.190	0.49
78_A	119_N	1.173	0.48
44_W	106_L	1.165	0.48
25_I	140_V	1.153	0.47
29_V	55_L	1.150	0.47
122_I	143_D	1.143	0.46
35_G	42_M	1.135	0.46
82_E	141_K	1.129	0.45
74_T	136_V	1.126	0.45
47_K	89_G	1.124	0.45
27_E	104_F	1.120	0.45
113_E	126_Y	1.103	0.44
70_W	142_W	1.103	0.44
77_S	137_V	1.099	0.44
61_F	111_I	1.098	0.44
81_Q	141_K	1.084	0.43
73_L	85_F	1.077	0.42
102_P	116_Q	1.073	0.42
75_N	78_A	1.072	0.42
32_D	61_F	1.071	0.42
89_G	95_R	1.065	0.42
128_Q	139_T	1.055	0.41
31_P	104_F	1.038	0.40
79_K	106_L	1.032	0.40
116_Q	120_D	1.019	0.39
113_E	117_L	1.019	0.39
57_S	72_T	1.010	0.38
96_L	104_F	1.005	0.38
111_I	125_S	0.993	0.38
79_K	85_F	0.992	0.37
50_A	110_F	0.971	0.36
35_G	85_F	0.967	0.36
13_K	98_H	0.963	0.36
20_Y	24_L	0.951	0.35
68_A	114_Q	0.946	0.35
80_K	85_F	0.941	0.35
90_P	122_I	0.928	0.34
120_D	143_D	0.925	0.34
20_Y	53_F	0.907	0.33
42_M	102_P	0.907	0.33
18_N	49_L	0.903	0.33
117_L	121_Q	0.899	0.32
100_K	140_V	0.894	0.32
75_N	119_N	0.889	0.32
57_S	138_L	0.888	0.32
63_A	67_E	0.872	0.31
96_L	102_P	0.859	0.30
95_R	104_F	0.854	0.30
33_M	63_A	0.850	0.30
28_I	86_E	0.830	0.29
15_I	27_E	0.828	0.29
89_G	104_F	0.827	0.29
31_P	38_Y	0.827	0.29
59_E	78_A	0.818	0.28
25_I	31_P	0.818	0.28
57_S	75_N	0.813	0.28
31_P	92_I	0.810	0.28
115_I	140_V	0.807	0.28
56_E	132_R	0.806	0.28
93_S	138_L	0.804	0.28
50_A	95_R	0.803	0.28
60_E	63_A	0.800	0.27
22_Y	85_F	0.792	0.27
27_E	123_A	0.791	0.27
25_I	56_E	0.779	0.26
72_T	117_L	0.765	0.26
82_E	127_E	0.763	0.26
52_K	83_L	0.762	0.26
22_Y	70_W	0.760	0.25
123_A	143_D	0.759	0.25
45_A	124_E	0.757	0.25
17_M	142_W	0.756	0.25
127_E	141_K	0.755	0.25
50_A	124_E	0.745	0.25
38_Y	92_I	0.739	0.25
14_E	132_R	0.739	0.25
86_E	135_K	0.737	0.24
41_M	127_E	0.728	0.24
62_P	73_L	0.726	0.24
64_F	114_Q	0.725	0.24
59_E	136_V	0.722	0.24
27_E	89_G	0.721	0.24
53_F	94_N	0.711	0.23
81_Q	120_D	0.711	0.23
83_L	115_I	0.707	0.23
88_E	96_L	0.702	0.23
24_L	77_S	0.699	0.23
86_E	128_Q	0.698	0.23
27_E	70_W	0.695	0.23
65_F	68_A	0.695	0.23
33_M	102_P	0.695	0.23
45_A	68_A	0.686	0.22
108_A	136_V	0.679	0.22
127_E	139_T	0.671	0.22
27_E	44_W	0.670	0.22
13_K	123_A	0.670	0.22
27_E	47_K	0.664	0.21
42_M	111_I	0.663	0.21
83_L	125_S	0.662	0.21
21_A	70_W	0.659	0.21
81_Q	121_Q	0.658	0.21
125_S	142_W	0.656	0.21
105_Q	125_S	0.644	0.21
101_E	119_N	0.643	0.21
61_F	138_L	0.642	0.20
19_A	111_I	0.638	0.20
13_K	133_A	0.636	0.20
46_G	109_G	0.635	0.20
46_G	107_E	0.635	0.20
24_L	68_A	0.630	0.20
125_S	140_V	0.627	0.20
25_I	48_H	0.625	0.20
75_N	83_L	0.617	0.20
36_Q	39_S	0.613	0.19
18_N	21_A	0.609	0.19
122_I	132_R	0.606	0.19
70_W	111_I	0.604	0.19
32_D	55_L	0.604	0.19
39_S	101_E	0.603	0.19
37_D	68_A	0.600	0.19
41_M	128_Q	0.591	0.19
59_E	70_W	0.589	0.18
55_L	114_Q	0.587	0.18
40_S	69_G	0.587	0.18
93_S	108_A	0.586	0.18
104_F	124_E	0.580	0.18
84_E	139_T	0.578	0.18
85_F	113_E	0.573	0.18
48_H	86_E	0.571	0.18
76_V	86_E	0.571	0.18
20_Y	45_A	0.570	0.18
83_L	92_I	0.564	0.18
47_K	63_A	0.561	0.17
83_L	142_W	0.557	0.17
67_E	119_N	0.550	0.17
95_R	102_P	0.548	0.17
17_M	44_W	0.547	0.17
49_L	104_F	0.543	0.17
30_L	66_E	0.543	0.17
21_A	80_K	0.537	0.17
21_A	111_I	0.536	0.17
130_K	135_K	0.536	0.17
37_D	94_N	0.534	0.17
57_S	118_M	0.533	0.17
94_N	98_H	0.530	0.16
27_E	102_P	0.528	0.16
23_E	80_K	0.528	0.16
29_V	64_F	0.523	0.16
40_S	105_Q	0.519	0.16
59_E	120_D	0.511	0.16
24_L	51_R	0.511	0.16
47_K	87_L	0.510	0.16
18_N	142_W	0.509	0.16
84_E	133_A	0.509	0.16
23_E	27_E	0.508	0.16
56_E	79_K	0.506	0.16
26_R	46_G	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3njcA	2	0.9797	100	0.295	Contact Map
2osoA	2	0.9122	99.7	0.691	Contact Map
2mnjA	1	0.1554	9.3	0.955	Contact Map
3aj1A	5	0.9054	9	0.955	Contact Map
2pa8L	1	0.4392	6	0.958	Contact Map
4qjvB	1	0.4392	5.8	0.959	Contact Map
1xppA	3	0.4527	3.8	0.962	Contact Map
1jnsA	1	0.2095	3.8	0.962	Contact Map
4kw3A	1	0.9122	3.4	0.963	Contact Map
3p9cA	2	0.5946	3.3	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.