RL10 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL10 - 50S ribosomal protein L10

UniProt:	P42923	Sequences: MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHEALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALAAKAVAEQKEEQGA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	166 (157)
Sequences:	2981 (1722)
Seq/√Len:	137.4

ECOLI - RL10
BACSU - RL10

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
119_T	122_E	3.594	1.00
75_F	110_A	3.050	1.00
18_K	51_E	2.986	1.00
155_K	158_A	2.742	1.00
155_K	159_E	2.708	1.00
21_E	86_T	2.572	1.00
5_I	9_K	2.548	1.00
16_A	20_K	2.540	1.00
62_R	65_E	2.435	1.00
40_E	44_Q	2.286	1.00
148_R	152_L	2.257	1.00
132_R	136_L	2.256	1.00
17_S	21_E	2.186	1.00
121_E	124_K	2.145	1.00
16_A	66_Q	2.136	1.00
98_D	102_N	2.028	1.00
44_Q	47_E	2.026	1.00
134_G	138_M	1.964	1.00
116_K	122_E	1.956	1.00
44_Q	98_D	1.955	1.00
124_K	128_E	1.942	1.00
37_E	103_H	1.889	1.00
113_I	118_S	1.726	1.00
15_I	55_Y	1.723	1.00
158_A	161_K	1.722	1.00
97_N	128_E	1.715	1.00
29_D	107_E	1.636	1.00
157_V	161_K	1.633	1.00
142_V	145_A	1.617	1.00
6_E	9_K	1.616	1.00
156_A	159_E	1.612	1.00
13_E	17_S	1.607	1.00
97_N	124_K	1.606	1.00
65_E	70_N	1.604	1.00
44_Q	102_N	1.602	1.00
34_N	37_E	1.588	1.00
49_N	87_E	1.536	1.00
99_F	103_H	1.485	1.00
138_M	141_S	1.462	1.00
149_N	152_L	1.449	1.00
17_S	20_K	1.443	1.00
28_V	52_F	1.380	1.00
131_S	135_L	1.338	1.00
28_V	81_A	1.329	1.00
61_R	73_N	1.319	1.00
98_D	101_K	1.316	1.00
120_V	124_K	1.312	1.00
29_D	109_K	1.298	1.00
45_L	50_V	1.278	1.00
43_K	47_E	1.264	1.00
55_Y	60_T	1.256	1.00
10_V	13_E	1.250	1.00
140_L	143_L	1.242	1.00
31_R	79_P	1.238	1.00
139_L	143_L	1.236	1.00
60_T	82_I	1.229	1.00
52_F	83_A	1.219	1.00
18_K	84_F	1.215	1.00
52_F	81_A	1.213	1.00
38_V	52_F	1.210	1.00
131_S	134_G	1.210	1.00
16_A	67_A	1.196	1.00
71_G	117_V	1.179	0.99
122_E	125_A	1.178	0.99
150_L	154_A	1.172	0.99
9_K	12_V	1.169	0.99
65_E	73_N	1.148	0.99
19_L	60_T	1.145	0.99
41_L	99_F	1.142	0.99
19_L	64_V	1.133	0.99
9_K	13_E	1.132	0.99
90_V	94_K	1.127	0.99
133_E	136_L	1.115	0.99
137_S	141_S	1.106	0.99
80_N	109_K	1.082	0.99
149_N	153_A	1.080	0.99
7_T	10_V	1.079	0.99
88_D	91_A	1.077	0.99
70_N	73_N	1.072	0.99
152_L	155_K	1.051	0.99
27_I	72_L	1.038	0.99
139_L	142_V	1.027	0.99
97_N	127_A	1.008	0.98
6_E	10_V	1.008	0.98
33_L	106_L	1.004	0.98
48_A	95_V	0.985	0.98
40_E	102_N	0.975	0.98
36_S	40_E	0.969	0.98
45_L	81_A	0.965	0.98
151_A	155_K	0.958	0.98
29_D	80_N	0.950	0.98
140_L	144_Q	0.947	0.98
136_L	140_L	0.946	0.98
10_V	14_E	0.944	0.98
15_I	60_T	0.943	0.98
137_S	140_L	0.931	0.97
45_L	96_L	0.914	0.97
50_V	83_A	0.909	0.97
60_T	80_N	0.893	0.97
14_E	53_K	0.893	0.97
26_I	83_A	0.857	0.96
85_S	92_P	0.848	0.95
153_A	157_V	0.847	0.95
152_L	156_A	0.845	0.95
37_E	105_A	0.845	0.95
145_A	149_N	0.828	0.95
58_T	61_R	0.817	0.94
66_Q	70_N	0.816	0.94
11_V	59_M	0.807	0.94
19_L	84_F	0.806	0.94
35_V	39_T	0.804	0.94
97_N	108_I	0.799	0.94
45_L	95_V	0.792	0.93
76_L	82_I	0.791	0.93
23_K	87_E	0.791	0.93
14_E	18_K	0.787	0.93
140_L	151_A	0.781	0.93
124_K	127_A	0.773	0.93
125_A	128_E	0.769	0.92
139_L	150_L	0.767	0.92
51_E	86_T	0.767	0.92
7_T	11_V	0.764	0.92
5_I	12_V	0.761	0.92
142_V	146_P	0.754	0.92
38_V	81_A	0.753	0.92
157_V	160_Q	0.740	0.91
83_A	96_L	0.739	0.91
41_L	103_H	0.737	0.91
37_E	40_E	0.735	0.91
149_N	156_A	0.734	0.91
13_E	16_A	0.732	0.90
48_A	91_A	0.726	0.90
19_L	25_T	0.726	0.90
45_L	92_P	0.720	0.90
27_I	80_N	0.717	0.90
101_K	128_E	0.716	0.89
8_K	12_V	0.716	0.89
152_L	161_K	0.716	0.89
69_L	112_V	0.714	0.89
71_G	74_D	0.712	0.89
60_T	64_V	0.710	0.89
23_K	114_E	0.707	0.89
33_L	103_H	0.707	0.89
43_K	46_R	0.703	0.89
75_F	117_V	0.694	0.88
150_L	157_V	0.692	0.88
83_A	93_A	0.692	0.88
24_S	85_S	0.686	0.87
111_G	123_V	0.684	0.87
49_N	86_T	0.680	0.87
107_E	120_V	0.673	0.86
25_T	82_I	0.673	0.86
152_L	159_E	0.667	0.86
12_V	59_M	0.666	0.86
50_V	95_V	0.665	0.86
40_E	103_H	0.665	0.86
140_L	146_P	0.656	0.85
55_Y	59_M	0.653	0.85
138_M	142_V	0.652	0.85
96_L	106_L	0.652	0.85
25_T	64_V	0.643	0.84
61_R	77_T	0.642	0.84
28_V	106_L	0.638	0.83
13_E	66_Q	0.635	0.83
96_L	108_I	0.633	0.83
27_I	110_A	0.630	0.83
5_I	62_R	0.630	0.83
100_A	103_H	0.628	0.82
61_R	74_D	0.628	0.82
45_L	52_F	0.628	0.82
26_I	85_S	0.625	0.82
143_L	148_R	0.622	0.82
154_A	158_A	0.622	0.82
103_H	107_E	0.616	0.81
33_L	37_E	0.615	0.81
50_V	92_P	0.614	0.81
57_N	109_K	0.613	0.81
153_A	156_A	0.611	0.81
36_S	39_T	0.604	0.80
44_Q	48_A	0.600	0.79
97_N	101_K	0.598	0.79
11_V	14_E	0.594	0.79
18_K	86_T	0.593	0.79
74_D	77_T	0.590	0.78
76_L	80_N	0.587	0.78
64_V	67_A	0.585	0.78
155_K	161_K	0.583	0.77
29_D	82_I	0.580	0.77
44_Q	95_V	0.579	0.77
148_R	161_K	0.579	0.77
20_K	68_E	0.578	0.77
141_S	145_A	0.575	0.76
48_A	94_K	0.574	0.76
21_E	51_E	0.571	0.76
100_A	106_L	0.569	0.76
15_I	19_L	0.569	0.76
30_Y	38_V	0.569	0.76
15_I	84_F	0.566	0.75
72_L	80_N	0.565	0.75
64_V	68_E	0.562	0.75
118_S	126_L	0.561	0.75
88_D	95_V	0.558	0.74
72_L	109_K	0.556	0.74
35_V	38_V	0.556	0.74
50_V	59_M	0.553	0.74
29_D	105_A	0.549	0.73
72_L	76_L	0.544	0.72
21_E	87_E	0.539	0.72
108_I	123_V	0.538	0.72
147_V	158_A	0.538	0.72
139_L	146_P	0.536	0.71
5_I	8_K	0.533	0.71
64_V	76_L	0.533	0.71
141_S	148_R	0.533	0.71
128_E	134_G	0.532	0.71
55_Y	82_I	0.531	0.71
152_L	158_A	0.530	0.71
57_N	80_N	0.529	0.70
22_S	84_F	0.525	0.70
85_S	110_A	0.525	0.70
11_V	58_T	0.525	0.70
64_V	73_N	0.524	0.70
140_L	149_N	0.523	0.70
50_V	85_S	0.522	0.69
126_L	129_L	0.519	0.69
23_K	131_S	0.515	0.68
72_L	117_V	0.514	0.68
144_Q	147_V	0.514	0.68
118_S	122_E	0.513	0.68
22_S	25_T	0.513	0.68
143_L	147_V	0.507	0.67
130_P	135_L	0.507	0.67
30_Y	33_L	0.505	0.67
98_D	134_G	0.503	0.67
113_I	123_V	0.502	0.66
130_P	138_M	0.500	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kix5	1	0.8916	100	0.121	Contact Map
1zavA	1	0.9699	100	0.174	Contact Map
3j7yI	1	0.7289	100	0.179	Contact Map
1vq8G	1	0	99.9	0.529	Contact Map
3j65n	1	0.988	99.9	0.534	Contact Map
3a1yG	1	0.6145	99.9	0.534	Contact Map
4hubG	1	0.9518	99.9	0.535	Contact Map
3j21k	1	0.9277	99.9	0.545	Contact Map
4nwbA	2	0.9217	99.9	0.556	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.