NASE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NASE - Assimilatory nitrite reductase [NAD(P)H] small subunit

UniProt:	P42436	Sequences: MVNKDVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSDGSIRAIENRCPHKGGVLAEGIVSGQYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYLVY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	106 (96)
Sequences:	2994 (2039)
Seq/√Len:	208.1

ECOLI - HCAC NIRD YEAW
BACSU - NASE
SULSO - Q97YS8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_C	101_H	4.354	1.00
8_K	96_L	2.623	1.00
14_I	42_I	2.504	1.00
45_I	90_V	2.340	1.00
10_C	103_Y	2.177	1.00
96_L	103_Y	2.105	1.00
46_E	91_K	1.939	1.00
76_S	79_D	1.939	1.00
47_N	57_A	1.934	1.00
98_E	103_Y	1.877	1.00
13_K	101_H	1.748	1.00
13_K	16_E	1.733	1.00
56_L	90_V	1.654	1.00
64_Q	78_E	1.634	1.00
30_K	46_E	1.630	1.00
54_G	69_P	1.597	1.00
64_Q	76_S	1.583	1.00
41_S	78_E	1.563	1.00
61_V	77_L	1.508	1.00
46_E	93_Y	1.493	1.00
73_W	86_D	1.486	1.00
10_C	13_K	1.450	1.00
32_L	44_A	1.435	1.00
65_Y	74_K	1.397	1.00
22_G	33_A	1.382	1.00
19_E	36_K	1.374	1.00
31_E	47_N	1.371	1.00
22_G	35_F	1.355	1.00
42_I	95_T	1.323	1.00
35_F	45_I	1.278	1.00
14_I	97_I	1.269	1.00
81_I	89_C	1.241	1.00
12_G	17_L	1.225	1.00
47_N	55_V	1.166	1.00
65_Y	83_Q	1.163	1.00
36_K	40_G	1.154	1.00
82_V	89_C	1.140	1.00
42_I	97_I	1.130	1.00
48_R	53_G	1.123	1.00
15_E	100_E	1.110	1.00
16_E	23_K	1.109	1.00
73_W	82_V	1.096	1.00
13_K	100_E	1.084	1.00
54_G	70_M	1.082	1.00
37_L	64_Q	1.062	1.00
14_I	100_E	1.030	1.00
97_I	102_V	1.023	1.00
22_G	61_V	1.015	1.00
36_K	42_I	1.014	1.00
49_C	71_H	1.008	1.00
35_F	66_V	1.005	1.00
24_T	47_N	1.002	1.00
37_L	43_R	1.001	1.00
18_P	21_L	0.999	1.00
18_P	36_K	0.996	1.00
49_C	68_C	0.964	1.00
37_L	41_S	0.948	0.99
82_V	85_P	0.945	0.99
50_P	75_I	0.943	0.99
50_P	90_V	0.928	0.99
43_R	92_T	0.924	0.99
52_K	70_M	0.921	0.99
12_G	34_V	0.910	0.99
22_G	66_V	0.907	0.99
68_C	71_H	0.905	0.99
17_L	42_I	0.901	0.99
8_K	103_Y	0.875	0.99
24_T	57_A	0.872	0.99
42_I	102_V	0.850	0.99
43_R	78_E	0.841	0.99
50_P	73_W	0.830	0.99
24_T	31_E	0.829	0.99
9_V	27_I	0.824	0.99
24_T	55_V	0.822	0.98
34_V	42_I	0.822	0.98
82_V	86_D	0.819	0.98
76_S	83_Q	0.817	0.98
19_E	40_G	0.816	0.98
73_W	89_C	0.814	0.98
60_I	67_F	0.801	0.98
52_K	73_W	0.789	0.98
20_Q	36_K	0.788	0.98
30_K	93_Y	0.788	0.98
33_A	57_A	0.778	0.98
12_G	102_V	0.769	0.98
60_I	72_D	0.761	0.98
11_I	104_L	0.759	0.97
27_I	30_K	0.757	0.97
26_Y	31_E	0.756	0.97
19_E	39_D	0.755	0.97
17_L	34_V	0.748	0.97
35_F	77_L	0.745	0.97
51_H	75_I	0.743	0.97
74_K	84_E	0.741	0.97
50_P	89_C	0.741	0.97
97_I	100_E	0.740	0.97
47_N	90_V	0.735	0.97
51_H	68_C	0.720	0.97
33_A	45_I	0.705	0.96
17_L	21_L	0.691	0.96
55_V	70_M	0.689	0.96
32_L	104_L	0.683	0.95
73_W	85_P	0.680	0.95
45_I	92_T	0.680	0.95
67_F	74_K	0.677	0.95
67_F	72_D	0.676	0.95
48_R	55_V	0.674	0.95
37_L	77_L	0.670	0.95
53_G	70_M	0.652	0.94
30_K	91_K	0.650	0.94
26_Y	29_D	0.647	0.94
39_D	64_Q	0.643	0.94
11_I	44_A	0.643	0.94
50_P	86_D	0.643	0.94
85_P	88_G	0.642	0.94
11_I	25_V	0.641	0.93
41_S	64_Q	0.632	0.93
51_H	71_H	0.627	0.93
27_I	104_L	0.620	0.92
18_P	22_G	0.618	0.92
45_I	77_L	0.603	0.91
76_S	81_I	0.599	0.91
8_K	98_E	0.595	0.91
17_L	23_K	0.577	0.89
33_A	90_V	0.568	0.89
17_L	36_K	0.566	0.88
79_D	92_T	0.565	0.88
46_E	90_V	0.557	0.88
62_S	67_F	0.554	0.87
72_D	84_E	0.550	0.87
69_P	72_D	0.549	0.87
17_L	102_V	0.549	0.87
31_E	46_E	0.546	0.87
37_L	63_G	0.544	0.86
12_G	23_K	0.530	0.85
25_V	34_V	0.526	0.85
50_P	84_E	0.521	0.84
53_G	72_D	0.517	0.84
61_V	67_F	0.512	0.83
12_G	16_E	0.511	0.83
51_H	85_P	0.504	0.82
86_D	89_C	0.502	0.82
74_K	83_Q	0.501	0.82
84_E	87_H	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gceA	1	0.9434	100	0.267	Contact Map
1vm9A	1	0.9434	100	0.269	Contact Map
4aivA	1	0.9717	100	0.271	Contact Map
3c0dA	1	0.9528	100	0.271	Contact Map
2jzaA	1	0.9623	100	0.272	Contact Map
3dqyA	1	0.934	100	0.273	Contact Map
1fqtA	2	0.9434	100	0.273	Contact Map
2de6D	1	0.934	100	0.274	Contact Map
2i7fA	1	0.934	100	0.275	Contact Map
2qpzA	1	0.9528	100	0.276	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.