HPS - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HPS - 3-hexulose-6-phosphate synthase

UniProt:	P42405	Sequences: MELQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVKEIKEAFPQLKVLADLKIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKKKILVDMINVKDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTAIAGGIKLDTLPEVIQQKPDLVIVGGGITSAADKAETASKMKQLIVQG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	210 (201)
Sequences:	3252 (2135)
Seq/√Len:	150.6

ECOLI - ULAD SGBH PYRF
BACSU - HPS PYRF
SULSO - Q980S5 PYRF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_K	50_A	3.787	1.00
11_N	14_E	3.587	1.00
195_D	198_E	3.407	1.00
85_G	107_L	3.258	1.00
48_K	79_D	3.239	1.00
87_T	91_T	2.508	1.00
42_R	45_K	2.492	1.00
197_A	201_S	2.307	1.00
115_D	118_S	2.290	1.00
174_P	206_L	2.286	1.00
89_D	93_K	2.270	1.00
16_I	46_E	2.262	1.00
198_E	202_K	2.214	1.00
193_A	199_T	2.191	1.00
12_I	46_E	2.142	1.00
89_D	122_E	2.140	1.00
3_L	186_V	2.110	1.00
96_V	100_K	2.104	1.00
170_L	189_G	2.032	1.00
33_T	37_I	2.021	1.00
154_K	182_D	2.010	1.00
174_P	178_Q	1.886	1.00
70_I	73_A	1.883	1.00
92_I	144_K	1.862	1.00
153_I	163_A	1.803	1.00
25_Y	201_S	1.788	1.00
117_E	128_V	1.750	1.00
127_G	130_Y	1.681	1.00
9_L	18_L	1.668	1.00
154_K	163_A	1.663	1.00
140_Q	158_K	1.657	1.00
175_E	178_Q	1.656	1.00
181_P	184_V	1.612	1.00
117_E	121_K	1.607	1.00
133_V	156_T	1.606	1.00
12_I	43_A	1.592	1.00
31_I	47_I	1.512	1.00
90_A	93_K	1.496	1.00
12_I	39_E	1.493	1.00
4_Q	28_V	1.486	1.00
37_I	62_I	1.484	1.00
55_K	79_D	1.478	1.00
18_L	22_V	1.470	1.00
17_E	21_E	1.452	1.00
62_I	73_A	1.433	1.00
3_L	200_A	1.429	1.00
14_E	17_E	1.407	1.00
35_V	39_E	1.379	1.00
46_E	49_E	1.366	1.00
93_K	97_E	1.361	1.00
89_D	142_E	1.358	1.00
21_E	196_K	1.357	1.00
170_L	203_M	1.355	1.00
89_D	141_A	1.333	1.00
147_F	168_I	1.330	1.00
71_M	101_K	1.324	1.00
21_E	195_D	1.321	1.00
201_S	205_Q	1.316	1.00
126_L	134_H	1.313	1.00
89_D	138_D	1.287	1.00
140_Q	157_V	1.279	1.00
6_A	187_G	1.277	1.00
198_E	201_S	1.275	1.00
15_A	35_V	1.264	1.00
106_I	144_K	1.260	1.00
175_E	179_Q	1.259	1.00
19_V	29_V	1.253	1.00
45_K	49_E	1.246	1.00
29_V	54_L	1.239	1.00
5_L	26_I	1.223	1.00
12_I	16_I	1.213	1.00
69_E	95_A	1.207	1.00
110_M	114_K	1.202	1.00
4_Q	183_L	1.174	1.00
202_K	205_Q	1.171	1.00
202_K	206_L	1.171	1.00
38_N	72_K	1.169	1.00
70_I	81_I	1.167	1.00
165_A	181_P	1.165	1.00
69_E	91_T	1.158	1.00
151_T	155_N	1.157	1.00
163_A	182_D	1.154	1.00
137_Y	156_T	1.147	1.00
28_V	55_K	1.145	1.00
5_L	191_T	1.139	1.00
10_V	14_E	1.136	1.00
119_R	123_I	1.134	1.00
94_G	97_E	1.132	1.00
21_E	197_A	1.127	1.00
98_E	102_Q	1.120	0.99
152_T	156_T	1.115	0.99
199_T	202_K	1.109	0.99
82_T	108_V	1.098	0.99
110_M	131_I	1.089	0.99
82_T	106_I	1.086	0.99
35_V	43_A	1.086	0.99
126_L	130_Y	1.080	0.99
151_T	179_Q	1.072	0.99
131_I	135_T	1.069	0.99
19_V	47_I	1.067	0.99
62_I	69_E	1.067	0.99
66_G	91_T	1.065	0.99
177_I	184_V	1.048	0.99
26_I	200_A	1.030	0.99
28_V	80_I	1.019	0.99
120_A	126_L	1.014	0.99
150_L	163_A	0.997	0.99
27_D	54_L	0.996	0.99
118_S	122_E	0.988	0.99
72_K	75_E	0.983	0.99
16_I	20_K	0.982	0.99
171_D	206_L	0.981	0.99
24_Q	197_A	0.976	0.99
90_A	94_G	0.973	0.99
153_I	157_V	0.954	0.98
86_A	135_T	0.929	0.98
38_N	75_E	0.928	0.98
133_V	152_T	0.928	0.98
162_T	182_D	0.923	0.98
102_Q	105_K	0.919	0.98
58_A	78_A	0.917	0.98
75_E	102_Q	0.912	0.98
146_S	149_E	0.907	0.98
44_V	76_A	0.905	0.98
96_V	145_N	0.903	0.98
3_L	204_K	0.899	0.98
190_I	200_A	0.893	0.97
86_A	131_I	0.893	0.97
39_E	42_R	0.893	0.97
117_E	127_G	0.888	0.97
200_A	204_K	0.886	0.97
29_V	47_I	0.885	0.97
25_Y	197_A	0.876	0.97
69_E	87_T	0.872	0.97
71_M	98_E	0.871	0.97
133_V	137_Y	0.870	0.97
16_I	19_V	0.869	0.97
81_I	99_A	0.866	0.97
150_L	181_P	0.861	0.97
106_I	164_I	0.860	0.97
41_L	44_V	0.858	0.97
36_V	60_L	0.852	0.97
92_I	142_E	0.848	0.96
197_A	200_A	0.847	0.96
83_V	92_I	0.840	0.96
36_V	41_L	0.830	0.96
114_K	119_R	0.828	0.96
86_A	110_M	0.827	0.96
82_T	92_I	0.826	0.96
71_M	75_E	0.825	0.96
89_D	92_I	0.824	0.96
94_G	98_E	0.814	0.96
22_V	197_A	0.813	0.96
70_I	99_A	0.806	0.95
71_M	102_Q	0.801	0.95
7_L	31_I	0.801	0.95
12_I	42_R	0.800	0.95
157_V	161_K	0.798	0.95
9_L	15_A	0.793	0.95
129_D	152_T	0.791	0.95
27_D	200_A	0.791	0.95
137_Y	157_V	0.790	0.95
126_L	131_I	0.783	0.95
85_G	139_L	0.773	0.94
163_A	183_L	0.773	0.94
47_I	54_L	0.772	0.94
100_K	103_K	0.770	0.94
118_S	121_K	0.768	0.94
43_A	46_E	0.762	0.94
44_V	56_V	0.759	0.94
107_L	139_L	0.759	0.94
5_L	22_V	0.759	0.94
23_E	29_V	0.759	0.94
34_P	191_T	0.758	0.94
80_I	183_L	0.758	0.94
16_I	50_A	0.753	0.93
39_E	43_A	0.750	0.93
170_L	206_L	0.750	0.93
170_L	199_T	0.743	0.93
23_E	26_I	0.743	0.93
107_L	144_K	0.741	0.93
74_S	103_K	0.734	0.92
14_E	21_E	0.733	0.92
57_L	82_T	0.728	0.92
195_D	199_T	0.725	0.92
9_L	191_T	0.725	0.92
42_R	46_E	0.723	0.92
134_H	138_D	0.721	0.92
90_A	119_R	0.721	0.92
133_V	157_V	0.718	0.92
13_P	16_I	0.717	0.92
186_V	203_M	0.717	0.92
203_M	206_L	0.712	0.91
162_T	183_L	0.712	0.91
18_L	21_E	0.711	0.91
86_A	114_K	0.706	0.91
82_T	161_K	0.702	0.91
115_D	119_R	0.700	0.91
17_E	20_K	0.694	0.90
5_L	18_L	0.693	0.90
28_V	79_D	0.692	0.90
199_T	203_M	0.690	0.90
24_Q	27_D	0.690	0.90
5_L	190_I	0.684	0.90
136_G	140_Q	0.680	0.89
80_I	106_I	0.679	0.89
119_R	128_V	0.674	0.89
139_L	144_K	0.674	0.89
19_V	39_E	0.673	0.89
7_L	47_I	0.670	0.89
56_V	78_A	0.669	0.88
171_D	174_P	0.666	0.88
37_I	73_A	0.665	0.88
33_T	62_I	0.664	0.88
7_L	19_V	0.664	0.88
100_K	105_K	0.654	0.87
63_M	86_A	0.654	0.87
31_I	35_V	0.653	0.87
18_L	196_K	0.651	0.87
42_R	49_E	0.646	0.87
101_K	104_K	0.646	0.87
173_L	184_V	0.646	0.87
4_Q	164_I	0.644	0.87
23_E	54_L	0.643	0.86
119_R	122_E	0.642	0.86
74_S	81_I	0.637	0.86
110_M	135_T	0.635	0.86
26_I	54_L	0.633	0.86
84_L	166_G	0.631	0.85
189_G	203_M	0.630	0.85
120_A	128_V	0.629	0.85
13_P	17_E	0.628	0.85
22_V	200_A	0.625	0.85
152_T	155_N	0.623	0.85
74_S	102_Q	0.616	0.84
84_L	111_I	0.613	0.84
58_A	73_A	0.611	0.84
46_E	50_A	0.609	0.83
137_Y	141_A	0.606	0.83
31_I	43_A	0.606	0.83
123_I	131_I	0.605	0.83
61_K	64_D	0.601	0.83
26_I	204_K	0.600	0.82
63_M	84_L	0.598	0.82
173_L	203_M	0.595	0.82
24_Q	54_L	0.593	0.82
48_K	56_V	0.592	0.82
124_D	131_I	0.592	0.82
117_E	125_A	0.592	0.82
95_A	98_E	0.590	0.81
131_I	134_H	0.587	0.81
173_L	180_K	0.585	0.81
10_V	72_K	0.584	0.81
199_T	206_L	0.582	0.80
85_G	132_C	0.581	0.80
22_V	54_L	0.581	0.80
109_D	112_N	0.579	0.80
34_P	68_Y	0.579	0.80
97_E	101_K	0.577	0.80
70_I	95_A	0.571	0.79
120_A	123_I	0.570	0.79
169_K	189_G	0.569	0.79
4_Q	80_I	0.567	0.79
65_A	166_G	0.564	0.78
137_Y	140_Q	0.564	0.78
98_E	101_K	0.557	0.78
28_V	54_L	0.555	0.77
111_I	114_K	0.554	0.77
31_I	36_V	0.552	0.77
19_V	22_V	0.552	0.77
47_I	50_A	0.550	0.77
97_E	100_K	0.543	0.76
197_A	205_Q	0.541	0.76
57_L	112_N	0.538	0.75
109_D	113_V	0.537	0.75
96_V	99_A	0.536	0.75
74_S	98_E	0.536	0.75
35_V	38_N	0.534	0.75
63_M	114_K	0.533	0.74
28_V	183_L	0.531	0.74
150_L	154_K	0.531	0.74
86_A	124_D	0.530	0.74
25_Y	204_K	0.530	0.74
34_P	71_M	0.529	0.74
30_E	166_G	0.526	0.73
31_I	41_L	0.521	0.73
90_A	97_E	0.521	0.73
112_N	115_D	0.520	0.73
83_V	95_A	0.519	0.72
121_K	125_A	0.516	0.72
64_D	111_I	0.514	0.72
92_I	139_L	0.509	0.71
162_T	165_A	0.509	0.71
74_S	99_A	0.508	0.71
85_G	92_I	0.506	0.71
129_D	148_E	0.504	0.70
7_L	15_A	0.504	0.70
140_Q	160_A	0.503	0.70
169_K	185_I	0.503	0.70
154_K	183_L	0.502	0.70
3_L	15_A	0.501	0.70
187_G	191_T	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qw4B	4	0.9667	100	0.297	Contact Map
3gdmA	2	0.9571	100	0.301	Contact Map
3qw3A	2	0.9619	100	0.308	Contact Map
3r89A	2	0.9952	100	0.325	Contact Map
4mjzA	2	0.981	100	0.332	Contact Map
3ldvA	2	0.9762	100	0.339	Contact Map
3tr2A	2	0.981	100	0.34	Contact Map
1eixA	2	0.981	100	0.34	Contact Map
2ffcA	2	0.9857	100	0.343	Contact Map
1dbtA	2	0.9857	100	0.346	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.