YXIS - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YXIS - Uncharacterized protein YxiS

UniProt:	P42310	Sequences: MNEKQLTEAYERDENMMILVFAQWCVNHDLDPMELYAKAYPQQKLNESLKKTMDDLVVPKHEAEHIPDQTVIAVLEMFGNTDLAQALHEAISGRKQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	96 (91)
Sequences:	108 (88)
Seq/√Len:	9.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_N	51_K	4.747	1.00
68_D	94_R	3.750	0.97
4_K	8_E	2.504	0.81
61_H	64_E	2.375	0.77
11_E	55_D	2.367	0.77
22_A	57_V	2.305	0.75
90_A	93_G	2.189	0.71
8_E	11_E	2.109	0.68
20_V	73_A	2.099	0.67
91_I	94_R	1.866	0.58
53_M	87_L	1.839	0.57
35_L	42_Q	1.747	0.53
7_T	11_E	1.608	0.47
71_V	76_E	1.578	0.45
68_D	91_I	1.561	0.45
13_D	59_P	1.551	0.44
13_D	78_F	1.511	0.42
48_S	52_T	1.506	0.42
42_Q	92_S	1.498	0.42
12_R	15_N	1.490	0.41
19_L	58_V	1.487	0.41
26_V	59_P	1.475	0.41
76_E	88_H	1.475	0.41
56_L	70_T	1.446	0.40
8_E	94_R	1.434	0.39
70_T	77_M	1.241	0.31
29_D	37_A	1.218	0.31
16_M	58_V	1.204	0.30
19_L	22_A	1.194	0.30
38_K	65_H	1.187	0.29
38_K	90_A	1.141	0.28
38_K	45_L	1.129	0.27
48_S	77_M	1.074	0.25
26_V	53_M	1.067	0.25
67_P	81_T	1.047	0.25
6_L	10_Y	1.047	0.25
55_D	67_P	1.046	0.25
64_E	76_E	1.021	0.24
69_Q	81_T	1.018	0.24
53_M	65_H	1.007	0.23
19_L	57_V	0.990	0.23
15_N	52_T	0.988	0.23
78_F	87_L	0.982	0.22
38_K	59_P	0.979	0.22
5_Q	92_S	0.969	0.22
11_E	93_G	0.946	0.21
15_N	20_V	0.941	0.21
3_E	69_Q	0.940	0.21
10_Y	85_Q	0.933	0.21
50_K	69_Q	0.932	0.21
72_I	91_I	0.926	0.21
73_A	76_E	0.924	0.21
65_H	89_E	0.914	0.20
50_K	67_P	0.902	0.20
7_T	85_Q	0.896	0.20
28_H	33_M	0.896	0.20
71_V	90_A	0.893	0.20
38_K	89_E	0.881	0.20
21_F	84_A	0.878	0.19
29_D	32_P	0.877	0.19
24_W	41_P	0.877	0.19
24_W	43_Q	0.877	0.19
13_D	38_K	0.875	0.19
46_N	49_L	0.874	0.19
4_K	81_T	0.873	0.19
73_A	82_D	0.864	0.19
22_A	59_P	0.857	0.19
37_A	66_I	0.853	0.19
55_D	77_M	0.829	0.18
12_R	51_K	0.813	0.18
16_M	60_K	0.809	0.18
5_Q	53_M	0.809	0.18
45_L	53_M	0.806	0.18
6_L	44_K	0.804	0.18
38_K	86_A	0.790	0.17
47_E	51_K	0.788	0.17
15_N	33_M	0.787	0.17
15_N	48_S	0.779	0.17
22_A	26_V	0.776	0.17
22_A	58_V	0.772	0.17
8_E	78_F	0.767	0.17
70_T	74_V	0.764	0.17
51_K	94_R	0.763	0.16
16_M	89_E	0.761	0.16
34_E	52_T	0.746	0.16
52_T	85_Q	0.744	0.16
9_A	12_R	0.743	0.16
86_A	89_E	0.742	0.16
9_A	66_I	0.739	0.16
10_Y	49_L	0.730	0.16
23_Q	62_E	0.714	0.15
56_L	59_P	0.713	0.15
6_L	35_L	0.701	0.15
26_V	51_K	0.691	0.15
55_D	65_H	0.689	0.15
6_L	11_E	0.685	0.15
10_Y	65_H	0.681	0.15
9_A	37_A	0.680	0.15
4_K	37_A	0.675	0.14
22_A	94_R	0.667	0.14
71_V	92_S	0.666	0.14
3_E	44_K	0.658	0.14
26_V	61_H	0.633	0.14
72_I	87_L	0.623	0.13
72_I	85_Q	0.622	0.13
47_E	93_G	0.620	0.13
12_R	37_A	0.617	0.13
35_L	86_A	0.610	0.13
5_Q	37_A	0.607	0.13
19_L	88_H	0.595	0.13
5_Q	69_Q	0.589	0.13
18_I	91_I	0.587	0.13
26_V	64_E	0.582	0.13
23_Q	27_N	0.579	0.13
6_L	51_K	0.571	0.12
68_D	76_E	0.571	0.12
34_E	38_K	0.567	0.12
9_A	53_M	0.567	0.12
72_I	76_E	0.553	0.12
13_D	77_M	0.543	0.12
16_M	61_H	0.542	0.12
11_E	42_Q	0.541	0.12
78_F	81_T	0.539	0.12
6_L	88_H	0.538	0.12
85_Q	90_A	0.537	0.12
26_V	34_E	0.537	0.12
59_P	89_E	0.533	0.12
56_L	76_E	0.532	0.12
8_E	18_I	0.531	0.12
8_E	47_E	0.528	0.12
26_V	57_V	0.518	0.11
5_Q	77_M	0.505	0.11
33_M	37_A	0.504	0.11
29_D	93_G	0.503	0.11
56_L	69_Q	0.503	0.11
58_V	63_A	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1nvpD	1	0.5312	6.4	0.952	Contact Map
2lekA	1	0.4375	6.1	0.952	Contact Map
2jesA	5	0.875	6.1	0.952	Contact Map
1u1jA	1	0.5208	5.8	0.953	Contact Map
1tkeA	1	0.4583	5.5	0.953	Contact Map
5a2tA	12	0.7917	5.5	0.954	Contact Map
4pbyC	1	0	5.3	0.954	Contact Map
1nh2D	1	0.5521	5.3	0.954	Contact Map
4lqeA	3	0.5	4.7	0.955	Contact Map
1k7jA	1	0.6354	4.5	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.