YXII - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YXII - Uncharacterized protein YxiI

UniProt:	P42301	Sequences: MMNWRALSQTKQDRIWSEVNKIIKWKPGSRCHHIIPPDPYRVFDISSAMSSKAGHNDVSGVLSDLETSILKAFQLGTGKNDVMYALDWQHDGYTFSPHQAMPKDEFGEWPVPVFPNGDYYFFFHQDFSWGLLGDPWKCAITVFGEELLEAIDNDPPILFRNK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	162 (146)
Sequences:	104 (76)
Seq/√Len:	6.3

BACSU - YXII

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_V	137_K	3.123	0.82
44_D	70_L	2.659	0.70
36_P	141_T	2.509	0.66
87_D	90_H	2.501	0.65
34_I	132_L	2.294	0.58
32_H	137_K	2.266	0.57
36_P	40_Y	2.126	0.52
109_W	112_P	2.098	0.51
111_V	139_A	2.084	0.51
119_Y	135_P	1.982	0.47
45_I	140_I	1.935	0.45
93_Y	109_W	1.807	0.41
25_W	134_D	1.786	0.40
87_D	116_N	1.750	0.39
13_D	114_F	1.711	0.37
69_I	73_F	1.701	0.37
16_W	86_L	1.688	0.37
111_V	122_F	1.658	0.36
27_P	119_Y	1.641	0.35
19_V	123_F	1.623	0.35
117_G	135_P	1.577	0.33
119_Y	134_D	1.577	0.33
115_P	133_G	1.530	0.32
105_E	112_P	1.529	0.31
119_Y	136_W	1.470	0.30
86_L	115_P	1.470	0.30
42_V	143_F	1.464	0.29
145_E	153_N	1.445	0.29
27_P	136_W	1.437	0.29
40_Y	141_T	1.420	0.28
123_F	134_D	1.418	0.28
118_D	136_W	1.414	0.28
70_L	111_V	1.414	0.28
87_D	117_G	1.408	0.28
42_V	63_S	1.396	0.27
78_G	81_D	1.394	0.27
90_H	119_Y	1.387	0.27
71_K	151_I	1.383	0.27
16_W	133_G	1.360	0.26
27_P	135_P	1.359	0.26
64_D	132_L	1.341	0.26
27_P	120_Y	1.332	0.26
40_Y	140_I	1.321	0.25
12_Q	17_S	1.320	0.25
118_D	144_G	1.312	0.25
137_K	141_T	1.303	0.25
43_F	142_V	1.290	0.25
28_G	134_D	1.283	0.24
126_D	142_V	1.276	0.24
93_Y	112_P	1.269	0.24
12_Q	15_I	1.259	0.24
96_S	99_Q	1.253	0.24
96_S	155_P	1.253	0.24
95_F	109_W	1.247	0.23
16_W	115_P	1.242	0.23
115_P	118_D	1.241	0.23
137_K	143_F	1.237	0.23
15_I	85_A	1.231	0.23
73_F	116_N	1.215	0.23
49_M	116_N	1.212	0.22
25_W	136_W	1.211	0.22
39_P	77_T	1.207	0.22
16_W	89_Q	1.207	0.22
69_I	151_I	1.203	0.22
82_V	94_T	1.185	0.22
32_H	40_Y	1.183	0.22
72_A	128_S	1.173	0.22
90_H	134_D	1.167	0.21
93_Y	145_E	1.161	0.21
32_H	134_D	1.156	0.21
23_I	137_K	1.151	0.21
19_V	23_I	1.141	0.21
64_D	67_T	1.122	0.20
123_F	145_E	1.115	0.20
124_H	129_W	1.109	0.20
46_S	114_F	1.097	0.20
92_G	96_S	1.089	0.20
81_D	97_P	1.081	0.19
17_S	27_P	1.077	0.19
66_E	152_D	1.064	0.19
117_G	136_W	1.064	0.19
20_N	92_G	1.061	0.19
16_W	130_G	1.059	0.19
25_W	32_H	1.058	0.19
13_D	21_K	1.045	0.19
67_T	99_Q	1.042	0.18
98_H	113_V	1.041	0.18
23_I	134_D	1.040	0.18
93_Y	111_V	1.039	0.18
69_I	150_A	1.036	0.18
84_Y	152_D	1.026	0.18
108_E	112_P	1.010	0.18
104_D	107_G	1.005	0.18
11_K	121_F	1.004	0.18
98_H	150_A	0.990	0.17
136_W	144_G	0.963	0.17
44_D	111_V	0.944	0.16
83_M	124_H	0.924	0.16
76_G	84_Y	0.922	0.16
26_K	84_Y	0.908	0.16
95_F	122_F	0.902	0.16
39_P	146_E	0.901	0.16
130_G	143_F	0.890	0.15
20_N	28_G	0.885	0.15
86_L	133_G	0.873	0.15
83_M	99_Q	0.870	0.15
85_A	122_F	0.870	0.15
32_H	69_I	0.865	0.15
105_E	111_V	0.859	0.15
107_G	139_A	0.857	0.15
32_H	37_P	0.855	0.15
80_N	107_G	0.854	0.15
41_R	95_F	0.853	0.15
122_F	153_N	0.831	0.14
41_R	148_L	0.821	0.14
82_V	125_Q	0.819	0.14
36_P	131_L	0.814	0.14
131_L	140_I	0.813	0.14
108_E	116_N	0.809	0.14
97_P	147_L	0.809	0.14
72_A	110_P	0.807	0.14
81_D	105_E	0.805	0.14
88_W	120_Y	0.799	0.14
113_V	131_L	0.798	0.14
108_E	129_W	0.794	0.14
97_P	144_G	0.792	0.14
26_K	138_C	0.791	0.14
36_P	42_V	0.790	0.14
33_H	129_W	0.788	0.14
73_F	77_T	0.786	0.14
23_I	143_F	0.786	0.14
18_E	59_S	0.784	0.13
87_D	118_D	0.784	0.13
59_S	102_P	0.774	0.13
73_F	150_A	0.764	0.13
43_F	72_A	0.761	0.13
9_Q	15_I	0.760	0.13
38_D	105_E	0.754	0.13
45_I	131_L	0.742	0.13
90_H	120_Y	0.741	0.13
61_V	114_F	0.740	0.13
15_I	84_Y	0.739	0.13
19_V	50_S	0.731	0.13
118_D	135_P	0.716	0.12
7_L	15_I	0.715	0.12
36_P	140_I	0.715	0.12
71_K	155_P	0.712	0.12
74_Q	143_F	0.697	0.12
89_Q	116_N	0.695	0.12
40_Y	132_L	0.693	0.12
13_D	92_G	0.691	0.12
95_F	150_A	0.684	0.12
33_H	120_Y	0.682	0.12
118_D	133_G	0.679	0.12
25_W	135_P	0.678	0.12
19_V	34_I	0.677	0.12
87_D	115_P	0.670	0.12
151_I	156_P	0.667	0.12
134_D	137_K	0.663	0.12
52_K	65_L	0.662	0.12
31_C	137_K	0.661	0.12
32_H	42_V	0.660	0.12
44_D	113_V	0.660	0.12
64_D	152_D	0.658	0.11
23_I	130_G	0.656	0.11
77_T	98_H	0.651	0.11
71_K	74_Q	0.650	0.11
33_H	40_Y	0.646	0.11
67_T	71_K	0.641	0.11
49_M	114_F	0.635	0.11
43_F	68_S	0.631	0.11
87_D	91_D	0.625	0.11
43_F	151_I	0.623	0.11
27_P	134_D	0.623	0.11
37_P	133_G	0.620	0.11
7_L	10_T	0.619	0.11
90_H	135_P	0.613	0.11
127_F	131_L	0.612	0.11
25_W	120_Y	0.600	0.11
33_H	137_K	0.599	0.11
39_P	82_V	0.597	0.11
70_L	109_W	0.596	0.11
8_S	78_G	0.594	0.11
151_I	155_P	0.591	0.11
86_L	118_D	0.589	0.11
93_Y	139_A	0.586	0.10
123_F	127_F	0.584	0.10
10_T	17_S	0.584	0.10
18_E	98_H	0.582	0.10
73_F	83_M	0.580	0.10
68_S	73_F	0.579	0.10
31_C	46_S	0.575	0.10
77_T	123_F	0.569	0.10
32_H	45_I	0.568	0.10
62_L	138_C	0.565	0.10
43_F	129_W	0.562	0.10
31_C	92_G	0.561	0.10
70_L	112_P	0.558	0.10
70_L	148_L	0.558	0.10
62_L	112_P	0.555	0.10
22_I	116_N	0.552	0.10
92_G	127_F	0.541	0.10
7_L	44_D	0.540	0.10
105_E	109_W	0.538	0.10
81_D	129_W	0.536	0.10
105_E	108_E	0.532	0.10
63_S	127_F	0.532	0.10
39_P	96_S	0.532	0.10
48_A	83_M	0.529	0.10
97_P	130_G	0.521	0.10
124_H	128_S	0.519	0.10
65_L	143_F	0.518	0.10
42_V	141_T	0.516	0.10
6_A	10_T	0.508	0.09
85_A	127_F	0.506	0.09
92_G	155_P	0.504	0.09
69_I	84_Y	0.501	0.09
22_I	50_S	0.500	0.09
70_L	80_N	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wasA	4	0.6296	18.3	0.956	Contact Map
1kxgA	5	0.5432	16.3	0.957	Contact Map
3kf3A	2	0.4568	10.1	0.961	Contact Map
4j27A	1	0.8272	8.8	0.962	Contact Map
2yonA	1	0.1481	5.5	0.965	Contact Map
2l1nA	1	0.5185	4.7	0.966	Contact Map
4r1dB	1	0.179	4.6	0.966	Contact Map
3kalA	2	0.7037	4.3	0.967	Contact Map
3ugfA	2	0.4568	3.5	0.968	Contact Map
2zc0A	4	0.4198	3.3	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.