YXIE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YXIE - Universal stress protein YxiE

UniProt:	P42297	Sequences: MFNKMLVAIDGSDMSAKALDAAVHLAKEQQAELSILHVGREAVVTTSSLTGIVYVPEHFIDEIRNEVKKEGLKILENAKEKAAEKGVQAETIYANGEPAHEILNHAKEKGVSLIVVGSRGISGLKEMMLGSVSHKVSQLSTCPVLIVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	148 (132)
Sequences:	20003 (15984)
Seq/√Len:	1391.2

ECOLI - USPF USPG USPE USPD USPC USPA
BACSU - YXIE NHAX
HALSA - Q9HRP5 Q9HPP5 Q9HPQ8 Q9HPF7 Q9HRD8 Q9HP90 Q9HNX9 Q9HMJ0 Q9HMI9 Q9HHV8 Q9HHX5 Q9HHY0 Q9HMU1
SULSO - Q97X90 Q97V57 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_S	92_I	3.156	1.00
6_L	111_V	2.722	1.00
99_A	135_K	2.708	1.00
4_K	34_S	2.685	1.00
21_A	145_L	2.572	1.00
32_E	90_E	2.493	1.00
4_K	32_E	2.423	1.00
113_L	145_L	2.357	1.00
92_I	105_H	2.323	1.00
116_V	136_V	2.015	1.00
96_G	101_E	2.012	1.00
34_S	90_E	1.984	1.00
34_S	111_V	1.932	1.00
114_I	142_C	1.892	1.00
79_K	91_T	1.840	1.00
94_A	101_E	1.837	1.00
134_H	138_Q	1.803	1.00
34_S	105_H	1.772	1.00
106_A	114_I	1.764	1.00
20_D	81_K	1.729	1.00
36_L	105_H	1.699	1.00
7_V	22_A	1.693	1.00
8_A	116_V	1.659	1.00
38_V	101_E	1.649	1.00
8_A	102_I	1.564	1.00
101_E	104_N	1.509	1.00
107_K	141_T	1.439	1.00
114_I	140_S	1.429	1.00
25_L	29_Q	1.416	1.00
31_A	112_S	1.408	1.00
37_H	71_G	1.399	1.00
135_K	139_L	1.383	1.00
32_E	88_Q	1.373	1.00
22_A	26_A	1.369	1.00
68_K	72_L	1.368	1.00
7_V	19_L	1.332	1.00
94_A	105_H	1.303	1.00
103_L	139_L	1.301	1.00
106_A	141_T	1.299	1.00
71_G	75_L	1.255	1.00
72_L	76_E	1.238	1.00
114_I	136_V	1.232	1.00
98_P	132_V	1.206	1.00
16_A	81_K	1.178	1.00
36_L	94_A	1.176	1.00
4_K	112_S	1.160	1.00
140_S	144_V	1.153	1.00
105_H	111_V	1.105	1.00
38_V	98_P	1.093	1.00
27_K	85_K	1.088	1.00
64_R	68_K	1.084	1.00
124_L	128_M	1.070	1.00
16_A	77_N	1.065	1.00
106_A	142_C	1.065	1.00
76_E	79_K	1.057	1.00
15_S	18_A	1.050	1.00
74_I	78_A	1.044	1.00
118_S	146_I	1.040	1.00
78_A	82_A	1.039	1.00
69_K	73_K	1.038	1.00
106_A	111_V	1.037	1.00
74_I	77_N	1.031	1.00
103_L	106_A	1.022	1.00
67_V	70_E	1.021	1.00
126_E	134_H	1.019	1.00
5_M	113_L	1.016	1.00
4_K	111_V	1.005	1.00
59_F	62_E	1.002	1.00
21_A	25_L	1.002	1.00
65_N	69_K	0.994	1.00
11_G	37_H	0.975	1.00
116_V	133_S	0.966	1.00
24_H	28_E	0.954	1.00
36_L	102_I	0.952	1.00
137_S	146_I	0.944	1.00
123_G	126_E	0.943	1.00
19_L	35_I	0.942	1.00
29_Q	112_S	0.929	1.00
67_V	71_G	0.928	1.00
70_E	74_I	0.928	1.00
75_L	91_T	0.926	1.00
39_G	95_N	0.925	1.00
19_L	78_A	0.916	1.00
72_L	91_T	0.910	1.00
22_A	115_V	0.903	1.00
35_I	89_A	0.900	1.00
21_A	24_H	0.898	1.00
81_K	84_E	0.894	1.00
39_G	93_Y	0.879	1.00
71_G	74_I	0.877	1.00
12_S	15_S	0.872	1.00
9_I	35_I	0.868	1.00
23_V	82_A	0.865	1.00
61_D	65_N	0.863	1.00
76_E	80_E	0.863	1.00
133_S	146_I	0.842	1.00
103_L	136_V	0.842	1.00
26_A	33_L	0.838	1.00
23_V	87_V	0.835	1.00
21_A	143_P	0.831	1.00
22_A	33_L	0.831	1.00
70_E	73_K	0.829	1.00
97_E	100_H	0.827	1.00
121_I	125_K	0.824	1.00
118_S	133_S	0.820	1.00
16_A	20_D	0.816	1.00
62_E	65_N	0.813	1.00
6_L	36_L	0.811	1.00
103_L	140_S	0.810	1.00
8_A	117_G	0.808	1.00
78_A	81_K	0.802	1.00
77_N	81_K	0.800	1.00
17_K	20_D	0.799	1.00
71_G	93_Y	0.791	1.00
6_L	105_H	0.790	1.00
26_A	29_Q	0.784	1.00
27_K	86_G	0.776	1.00
7_V	33_L	0.775	1.00
23_V	85_K	0.769	1.00
9_I	19_L	0.768	1.00
19_L	23_V	0.765	1.00
96_G	104_N	0.763	1.00
115_V	145_L	0.756	1.00
82_A	89_A	0.753	1.00
77_N	80_E	0.750	1.00
9_I	18_A	0.742	1.00
66_E	70_E	0.736	1.00
6_L	114_I	0.736	1.00
21_A	147_V	0.729	1.00
102_I	136_V	0.727	1.00
9_I	78_A	0.725	1.00
9_I	16_A	0.713	1.00
25_L	28_E	0.713	1.00
99_A	132_V	0.713	1.00
38_V	96_G	0.712	1.00
66_E	69_K	0.709	1.00
76_E	91_T	0.709	1.00
123_G	127_M	0.702	1.00
39_G	71_G	0.701	1.00
110_G	142_C	0.699	1.00
101_E	105_H	0.698	1.00
5_M	115_V	0.693	1.00
12_S	120_G	0.692	1.00
22_A	31_A	0.687	1.00
61_D	64_R	0.684	1.00
124_L	127_M	0.682	1.00
75_L	79_K	0.673	1.00
79_K	89_A	0.671	1.00
24_H	27_K	0.669	1.00
26_A	31_A	0.664	1.00
116_V	146_I	0.663	1.00
73_K	77_N	0.662	1.00
69_K	72_L	0.660	1.00
9_I	15_S	0.657	1.00
120_G	129_L	0.649	1.00
35_I	78_A	0.646	1.00
65_N	68_K	0.646	1.00
129_L	133_S	0.645	1.00
35_I	82_A	0.642	1.00
23_V	27_K	0.640	1.00
14_M	17_K	0.638	1.00
60_I	64_R	0.635	1.00
82_A	85_K	0.634	1.00
99_A	103_L	0.633	1.00
80_E	84_E	0.618	1.00
73_K	76_E	0.615	1.00
60_I	63_I	0.614	1.00
99_A	136_V	0.613	1.00
7_V	18_A	0.609	1.00
64_R	95_N	0.605	1.00
16_A	74_I	0.602	1.00
5_M	26_A	0.601	1.00
62_E	66_E	0.596	1.00
18_A	115_V	0.591	1.00
100_H	104_N	0.583	1.00
37_H	74_I	0.582	1.00
16_A	78_A	0.580	1.00
137_S	144_V	0.580	1.00
115_V	147_V	0.579	1.00
92_I	95_N	0.579	1.00
36_L	101_E	0.576	1.00
13_D	16_A	0.576	1.00
118_S	128_M	0.575	1.00
25_L	145_L	0.563	1.00
11_G	74_I	0.562	1.00
25_L	115_V	0.561	1.00
107_K	142_C	0.558	1.00
35_I	91_T	0.557	1.00
11_G	78_A	0.553	1.00
103_L	135_K	0.552	1.00
99_A	139_L	0.542	1.00
25_L	31_A	0.529	1.00
117_G	147_V	0.523	1.00
8_A	98_P	0.523	1.00
81_K	85_K	0.521	1.00
23_V	81_K	0.516	1.00
111_V	114_I	0.505	1.00
71_G	82_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1mjhA	2	0.9392	99.9	0.127	Contact Map
5ahwA	4	0.9595	99.9	0.139	Contact Map
3s3tA	4	0.9527	99.9	0.139	Contact Map
2dumA	2	0.9324	99.9	0.141	Contact Map
3hgmA	2	0.973	99.9	0.142	Contact Map
2gm3A	2	0.8649	99.9	0.143	Contact Map
4wnyA	2	0.8514	99.9	0.149	Contact Map
3fg9A	3	0.9324	99.9	0.177	Contact Map
3tnjA	2	0.8446	99.9	0.178	Contact Map
3loqA	1	0.9122	99.9	0.18	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.