CWLJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CWLJ - Cell wall hydrolase CwlJ

UniProt:	P42249	Sequences: MAVVRATSADVDLMARLLRAEAEGEGKQGMLLVGNVGINRLRANCSDFKGLRTIRQMIYQPHAFEAVTHGYFYQRARDSERALARRSINGERRWPAKFSLWYFRPQGDCPAQWYNQPFVARFKSHCFYQPTAETCENVYNTF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	142 (139)
Sequences:	333 (156)
Seq/√Len:	13.3

BACSU - CWLJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
86_R	91_E	5.031	1.00
12_D	81_R	4.363	1.00
78_D	82_A	3.641	0.99
52_R	56_Q	2.922	0.96
53_T	56_Q	2.861	0.96
11_V	88_I	2.817	0.95
4_V	38_I	2.714	0.94
103_F	110_P	2.626	0.93
44_N	52_R	2.558	0.92
67_V	70_G	2.554	0.92
119_V	129_Q	2.444	0.90
114_Y	128_Y	2.366	0.89
33_V	37_G	2.239	0.86
10_D	54_I	2.212	0.85
37_G	57_M	2.212	0.85
17_L	61_P	2.208	0.85
112_Q	117_P	2.204	0.85
28_Q	32_L	2.041	0.80
14_M	37_G	2.036	0.80
8_S	85_R	2.028	0.79
11_V	85_R	1.891	0.74
9_A	12_D	1.887	0.74
18_L	38_I	1.871	0.74
104_R	124_S	1.834	0.72
25_E	36_V	1.797	0.70
3_V	42_R	1.642	0.63
86_R	93_R	1.574	0.60
32_L	97_K	1.555	0.59
13_L	55_R	1.493	0.56
27_K	79_S	1.456	0.54
9_A	81_R	1.435	0.53
65_E	102_Y	1.393	0.50
43_A	137_N	1.320	0.46
3_V	90_G	1.319	0.46
25_E	114_Y	1.317	0.46
11_V	81_R	1.316	0.46
17_L	63_A	1.306	0.46
44_N	56_Q	1.304	0.46
19_R	77_R	1.287	0.45
44_N	50_G	1.265	0.44
13_L	58_I	1.255	0.43
98_F	129_Q	1.223	0.41
33_V	87_S	1.210	0.41
37_G	87_S	1.190	0.40
8_S	89_N	1.142	0.37
118_F	128_Y	1.127	0.37
45_C	135_C	1.123	0.36
18_L	80_E	1.122	0.36
104_R	139_Y	1.121	0.36
5_R	82_A	1.103	0.35
8_S	12_D	1.086	0.35
4_V	136_E	1.080	0.34
28_Q	94_W	1.065	0.34
9_A	104_R	1.064	0.34
8_S	78_D	1.063	0.34
25_E	124_S	1.061	0.33
119_V	128_Y	1.057	0.33
31_L	35_N	1.047	0.33
99_S	131_T	1.044	0.33
102_Y	118_F	1.040	0.32
2_A	90_G	1.028	0.32
23_E	71_Y	1.027	0.32
28_Q	93_R	1.022	0.32
99_S	129_Q	1.020	0.32
31_L	83_L	1.013	0.31
5_R	8_S	0.982	0.30
23_E	77_R	0.979	0.30
6_A	27_K	0.976	0.30
86_R	90_G	0.971	0.29
24_G	67_V	0.968	0.29
33_V	97_K	0.960	0.29
115_N	123_K	0.955	0.29
24_G	137_N	0.955	0.29
99_S	112_Q	0.951	0.28
17_L	37_G	0.950	0.28
43_A	58_I	0.937	0.28
131_T	134_T	0.931	0.28
62_H	102_Y	0.919	0.27
38_I	136_E	0.880	0.26
7_T	12_D	0.864	0.25
99_S	110_P	0.864	0.25
128_Y	134_T	0.858	0.25
99_S	107_G	0.854	0.24
113_W	116_Q	0.851	0.24
94_W	137_N	0.846	0.24
22_A	33_V	0.843	0.24
7_T	55_R	0.837	0.24
6_A	119_V	0.836	0.24
32_L	96_A	0.834	0.24
18_L	102_Y	0.830	0.24
19_R	45_C	0.827	0.23
97_K	128_Y	0.822	0.23
7_T	99_S	0.820	0.23
14_M	61_P	0.813	0.23
51_L	58_I	0.804	0.23
33_V	42_R	0.803	0.23
120_A	123_K	0.797	0.22
5_R	50_G	0.790	0.22
65_E	92_R	0.790	0.22
48_F	101_W	0.789	0.22
82_A	128_Y	0.788	0.22
10_D	55_R	0.778	0.22
59_Y	132_A	0.777	0.22
8_S	104_R	0.774	0.21
95_P	120_A	0.772	0.21
76_A	81_R	0.761	0.21
5_R	27_K	0.761	0.21
6_A	11_V	0.760	0.21
8_S	11_V	0.760	0.21
78_D	111_A	0.753	0.21
98_F	117_P	0.752	0.21
90_G	127_F	0.741	0.20
4_V	18_L	0.735	0.20
87_S	93_R	0.719	0.20
93_R	137_N	0.718	0.20
3_V	121_R	0.708	0.19
113_W	135_C	0.707	0.19
26_G	30_M	0.702	0.19
17_L	102_Y	0.699	0.19
117_P	129_Q	0.695	0.19
7_T	50_G	0.679	0.18
51_L	57_M	0.671	0.18
32_L	94_W	0.662	0.18
54_I	92_R	0.662	0.18
48_F	95_P	0.660	0.18
92_R	103_F	0.650	0.17
59_Y	101_W	0.649	0.17
43_A	52_R	0.647	0.17
10_D	112_Q	0.643	0.17
4_V	51_L	0.640	0.17
23_E	65_E	0.638	0.17
19_R	23_E	0.637	0.17
70_G	73_Y	0.635	0.17
4_V	106_Q	0.634	0.17
4_V	119_V	0.631	0.17
41_L	48_F	0.630	0.17
35_N	83_L	0.629	0.17
35_N	95_P	0.628	0.17
85_R	89_N	0.627	0.17
43_A	50_G	0.627	0.17
78_D	81_R	0.627	0.17
45_C	95_P	0.625	0.17
5_R	132_A	0.624	0.17
47_D	77_R	0.621	0.17
14_M	87_S	0.617	0.16
90_G	121_R	0.615	0.16
23_E	66_A	0.612	0.16
112_Q	115_N	0.606	0.16
28_Q	31_L	0.604	0.16
14_M	17_L	0.602	0.16
62_H	118_F	0.601	0.16
33_V	115_N	0.600	0.16
41_L	101_W	0.599	0.16
6_A	55_R	0.598	0.16
53_T	128_Y	0.596	0.16
46_S	63_A	0.596	0.16
69_H	138_V	0.595	0.16
43_A	56_Q	0.589	0.16
65_E	103_F	0.583	0.15
5_R	137_N	0.581	0.15
8_S	55_R	0.578	0.15
62_H	127_F	0.578	0.15
19_R	74_Q	0.577	0.15
104_R	136_E	0.577	0.15
72_F	123_K	0.577	0.15
53_T	75_R	0.576	0.15
14_M	57_M	0.574	0.15
53_T	112_Q	0.572	0.15
43_A	78_D	0.570	0.15
98_F	139_Y	0.569	0.15
107_G	110_P	0.566	0.15
54_I	58_I	0.566	0.15
12_D	76_A	0.566	0.15
8_S	58_I	0.565	0.15
19_R	72_F	0.563	0.15
112_Q	118_F	0.561	0.15
66_A	71_Y	0.550	0.15
5_R	25_E	0.546	0.14
6_A	87_S	0.545	0.14
117_P	128_Y	0.540	0.14
70_G	137_N	0.535	0.14
23_E	74_Q	0.535	0.14
24_G	88_I	0.534	0.14
119_V	133_E	0.529	0.14
88_I	106_Q	0.529	0.14
63_A	102_Y	0.526	0.14
67_V	99_S	0.524	0.14
28_Q	122_F	0.524	0.14
118_F	129_Q	0.524	0.14
27_K	80_E	0.522	0.14
10_D	75_R	0.521	0.14
95_P	123_K	0.520	0.14
7_T	87_S	0.518	0.14
49_K	115_N	0.518	0.14
53_T	137_N	0.517	0.14
10_D	110_P	0.515	0.14
86_R	98_F	0.515	0.14
61_P	90_G	0.514	0.14
3_V	57_M	0.513	0.14
68_T	122_F	0.512	0.14
46_S	118_F	0.512	0.14
17_L	95_P	0.511	0.14
4_V	102_Y	0.510	0.14
55_R	114_Y	0.508	0.14
24_G	76_A	0.506	0.13
66_A	69_H	0.503	0.13
8_S	114_Y	0.502	0.13
24_G	41_L	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4f55A	1	0.8592	100	0.574	Contact Map
4fetB	1	0.8451	100	0.609	Contact Map
4iiwA	4	0.5282	15.7	0.961	Contact Map
4grcA	2	0.5211	13.5	0.962	Contact Map
4gt2B	2	0.5704	11.1	0.964	Contact Map
4g09A	2	0.338	10.2	0.964	Contact Map
2ofkA	1	0.2958	6.3	0.968	Contact Map
3r64A	4	0.4718	6	0.968	Contact Map
2r1fA	4	0.5423	5.6	0.968	Contact Map
2lydA	1	0.5563	4.2	0.97	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.