YXAI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YXAI - Uncharacterized protein YxaI

UniProt:	P42108	Sequences: MEKPAGFWIRFLAYFIDGIIVSVPSYIILFIINSVFVAGAVATNPYMTEEEYLVKYMTLAFLPTMLIMIVISVLYYGLLTASKMQGTLGKKILGLKVVNEQGERVSVGQGIGRYFAYILSGIIFYIGFIMIAFGEKKGLHDIICKTRVVYK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (133)
Sequences:	2085 (1639)
Seq/√Len:	142.1

BACSU - YXAI YCKC YCZC YTEJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_L	88_L	4.620	1.00
134_G	142_I	3.554	1.00
131_I	138_G	2.884	1.00
9_I	150_Y	2.827	1.00
130_M	139_L	2.722	1.00
5_A	95_L	2.717	1.00
16_I	93_L	2.708	1.00
116_A	143_I	2.496	1.00
105_V	110_G	2.457	1.00
99_N	109_Q	2.392	1.00
86_G	91_K	2.363	1.00
129_I	133_F	2.319	1.00
105_V	146_T	2.186	1.00
130_M	134_G	2.034	1.00
120_S	140_H	1.856	1.00
136_K	147_R	1.846	1.00
120_S	127_G	1.837	1.00
80_T	114_Y	1.754	1.00
16_I	92_I	1.668	1.00
129_I	132_A	1.659	1.00
30_F	34_S	1.607	1.00
12_L	93_L	1.570	1.00
81_A	107_V	1.566	1.00
14_Y	76_Y	1.566	1.00
7_F	131_I	1.518	1.00
100_E	136_K	1.484	1.00
124_F	127_G	1.482	1.00
6_G	9_I	1.481	1.00
11_F	131_I	1.463	1.00
98_V	149_V	1.432	1.00
3_K	150_Y	1.388	1.00
98_V	147_R	1.355	1.00
81_A	110_G	1.354	1.00
99_N	106_S	1.344	1.00
100_E	147_R	1.337	1.00
80_T	90_K	1.335	1.00
99_N	103_E	1.294	1.00
120_S	138_G	1.236	1.00
123_I	139_L	1.233	1.00
7_F	132_A	1.232	1.00
19_I	22_S	1.229	1.00
77_G	111_I	1.222	1.00
112_G	115_F	1.218	1.00
84_M	91_K	1.159	0.99
112_G	143_I	1.156	0.99
110_G	114_Y	1.123	0.99
80_T	117_Y	1.116	0.99
79_L	91_K	1.112	0.99
73_V	111_I	1.111	0.99
77_G	110_G	1.105	0.99
85_Q	98_V	1.098	0.99
106_S	109_Q	1.096	0.99
117_Y	120_S	1.088	0.99
4_P	147_R	1.086	0.99
16_I	20_I	1.077	0.99
85_Q	96_K	1.076	0.99
108_G	112_G	1.075	0.99
75_Y	80_T	1.061	0.99
80_T	138_G	1.057	0.99
19_I	23_V	1.057	0.99
120_S	128_F	1.053	0.99
86_G	95_L	1.048	0.99
6_G	132_A	1.047	0.99
120_S	124_F	1.041	0.99
80_T	97_V	1.026	0.99
114_Y	117_Y	1.008	0.99
15_F	19_I	1.004	0.99
22_S	26_Y	0.990	0.98
80_T	140_H	0.990	0.98
4_P	7_F	0.984	0.98
13_A	90_K	0.983	0.98
119_L	123_I	0.969	0.98
58_T	62_L	0.961	0.98
111_I	115_F	0.958	0.98
142_I	147_R	0.950	0.98
38_A	41_V	0.927	0.98
117_Y	140_H	0.922	0.97
77_G	107_V	0.908	0.97
72_S	76_Y	0.902	0.97
109_Q	112_G	0.901	0.97
107_V	111_I	0.896	0.97
78_L	83_K	0.893	0.97
8_W	132_A	0.887	0.97
39_G	42_A	0.870	0.96
11_F	14_Y	0.863	0.96
76_Y	87_T	0.862	0.96
117_Y	128_F	0.859	0.96
9_I	12_L	0.858	0.96
9_I	95_L	0.833	0.95
123_I	127_G	0.831	0.95
76_Y	80_T	0.831	0.95
74_L	107_V	0.829	0.95
116_A	140_H	0.827	0.95
107_V	110_G	0.823	0.95
77_G	87_T	0.819	0.95
74_L	78_L	0.819	0.95
100_E	145_K	0.819	0.95
73_V	114_Y	0.806	0.94
75_Y	78_L	0.802	0.94
137_K	143_I	0.798	0.94
97_V	110_G	0.795	0.94
136_K	142_I	0.783	0.94
116_A	120_S	0.781	0.94
29_L	33_N	0.781	0.94
24_P	71_I	0.777	0.93
33_N	37_V	0.775	0.93
120_S	123_I	0.765	0.93
6_G	131_I	0.757	0.92
88_L	92_I	0.755	0.92
77_G	115_F	0.748	0.92
130_M	142_I	0.746	0.92
116_A	127_G	0.743	0.92
6_G	137_K	0.742	0.92
17_D	89_G	0.742	0.92
73_V	77_G	0.738	0.91
79_L	84_M	0.737	0.91
9_I	93_L	0.736	0.91
121_G	124_F	0.735	0.91
127_G	130_M	0.734	0.91
16_I	90_K	0.728	0.91
60_A	63_P	0.725	0.91
120_S	125_Y	0.722	0.91
140_H	144_C	0.722	0.91
14_Y	18_G	0.710	0.90
33_N	36_F	0.710	0.90
92_I	126_I	0.707	0.90
58_T	61_F	0.707	0.90
99_N	145_K	0.705	0.90
98_V	104_R	0.702	0.89
99_N	105_V	0.700	0.89
26_Y	39_G	0.690	0.89
67_I	71_I	0.688	0.88
86_G	110_G	0.687	0.88
77_G	81_A	0.685	0.88
8_W	15_F	0.684	0.88
7_F	138_G	0.684	0.88
79_L	83_K	0.680	0.88
127_G	139_L	0.672	0.87
9_I	149_V	0.668	0.87
22_S	31_I	0.665	0.87
95_L	148_V	0.662	0.86
79_L	86_G	0.654	0.86
37_V	64_T	0.654	0.86
75_Y	81_A	0.653	0.86
40_A	43_T	0.647	0.85
40_A	70_V	0.645	0.85
25_S	36_F	0.641	0.85
123_I	126_I	0.637	0.84
75_Y	88_L	0.635	0.84
121_G	125_Y	0.635	0.84
75_Y	139_L	0.633	0.84
27_I	31_I	0.632	0.84
126_I	130_M	0.631	0.84
132_A	138_G	0.631	0.84
135_E	150_Y	0.631	0.84
147_R	150_Y	0.628	0.83
23_V	92_I	0.626	0.83
127_G	131_I	0.626	0.83
61_F	64_T	0.625	0.83
126_I	129_I	0.620	0.83
90_K	148_V	0.615	0.82
115_F	120_S	0.611	0.82
33_N	64_T	0.607	0.81
39_G	62_L	0.600	0.81
64_T	68_M	0.598	0.80
36_F	60_A	0.597	0.80
116_A	128_F	0.596	0.80
75_Y	87_T	0.595	0.80
90_K	97_V	0.593	0.80
31_I	34_S	0.590	0.79
28_I	67_I	0.587	0.79
133_F	142_I	0.583	0.79
126_I	139_L	0.582	0.78
68_M	132_A	0.575	0.78
85_Q	104_R	0.574	0.78
5_A	9_I	0.571	0.77
26_Y	60_A	0.571	0.77
26_Y	30_F	0.569	0.77
97_V	105_V	0.568	0.77
23_V	62_L	0.568	0.77
4_P	137_K	0.566	0.77
20_I	88_L	0.564	0.76
116_A	144_C	0.557	0.75
34_S	37_V	0.555	0.75
39_G	63_P	0.554	0.75
121_G	128_F	0.545	0.74
85_Q	88_L	0.542	0.73
114_Y	138_G	0.542	0.73
30_F	38_A	0.528	0.72
105_V	109_Q	0.528	0.72
104_R	134_G	0.527	0.71
36_F	39_G	0.527	0.71
35_V	40_A	0.519	0.70
32_I	63_P	0.518	0.70
90_K	144_C	0.510	0.69
117_Y	124_F	0.510	0.69
138_G	144_C	0.505	0.68
9_I	94_G	0.503	0.68
87_T	150_Y	0.500	0.67
80_T	134_G	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3dh4A	3	0.543	3.3	0.946	Contact Map
3kijA	1	0.4371	2.5	0.949	Contact Map
3cniA	2	0.3179	2.4	0.95	Contact Map
3g9kS	1	0.351	2	0.952	Contact Map
2f9sA	1	0.4172	1.9	0.952	Contact Map
2ot8C	1	0.0596	1.9	0.953	Contact Map
2cvbA	1	0.457	1.9	0.953	Contact Map
2cw3A	2	0	1.8	0.953	Contact Map
4tr3A	1	0.5232	1.7	0.954	Contact Map
3gqhA	3	0.4768	1.7	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.