XPT - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

XPT - Xanthine phosphoribosyltransferase

UniProt:	P42085	Sequences: MEALKRKIEEEGVVLSDQVLKVDSFLNHQIDPLLMQRIGDEFASRFAKDGITKIVTIESSGIAPAVMTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQPGRDELVKLGYRVESLARIQSLEEGKVSFVQEVHS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	194 (169)
Sequences:	4697 (2771)
Seq/√Len:	213.1

ECOLI - APT
BACSU - XPT APT PURR
HALSA - HPRL Q9HNG3
SULSO - Q980Q2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
119_H	146_S	3.216	1.00
90_N	111_G	2.683	1.00
157_S	177_R	2.637	1.00
53_K	118_D	2.579	1.00
94_A	138_S	2.536	1.00
94_A	142_Q	2.450	1.00
160_P	163_D	2.382	1.00
95_S	106_Q	2.329	1.00
10_E	20_L	2.316	1.00
97_Y	104_E	2.307	1.00
52_T	118_D	2.193	1.00
155_E	162_R	2.170	1.00
162_R	166_V	2.168	1.00
40_D	71_K	2.155	1.00
140_V	145_A	2.115	1.00
95_S	104_E	2.020	1.00
9_E	89_D	1.965	1.00
93_T	106_Q	1.941	1.00
133_A	152_I	1.929	1.00
134_H	138_S	1.926	1.00
45_R	173_E	1.886	1.00
36_Q	71_K	1.864	1.00
3_A	37_R	1.856	1.00
7_K	34_L	1.801	1.00
115_S	118_D	1.773	1.00
55_V	79_A	1.772	1.00
43_A	71_K	1.760	1.00
79_A	136_L	1.756	1.00
10_E	23_D	1.729	1.00
92_L	143_A	1.725	1.00
51_I	74_V	1.704	1.00
57_I	136_L	1.688	1.00
134_H	164_E	1.682	1.00
44_S	47_A	1.682	1.00
93_T	108_A	1.674	1.00
50_G	119_H	1.658	1.00
13_V	17_D	1.578	1.00
116_D	144_G	1.571	1.00
7_K	31_D	1.546	1.00
119_H	148_A	1.522	1.00
55_V	140_V	1.514	1.00
49_D	171_R	1.497	1.00
137_V	150_I	1.493	1.00
69_G	76_V	1.433	1.00
92_L	111_G	1.423	1.00
36_Q	70_L	1.414	1.00
35_M	66_V	1.404	1.00
42_F	151_G	1.390	1.00
41_E	44_S	1.384	1.00
46_F	151_G	1.375	1.00
133_A	150_I	1.373	1.00
20_L	23_D	1.354	1.00
46_F	121_L	1.337	1.00
150_I	170_Y	1.335	1.00
53_K	77_V	1.309	1.00
123_I	151_G	1.298	1.00
163_D	166_V	1.294	1.00
33_L	73_G	1.294	1.00
26_L	110_S	1.289	1.00
12_G	20_L	1.266	1.00
141_K	170_Y	1.223	1.00
114_L	145_A	1.212	1.00
89_D	110_S	1.211	1.00
42_F	68_T	1.196	1.00
122_I	136_L	1.192	1.00
43_A	68_T	1.177	1.00
46_F	149_G	1.174	1.00
163_D	167_K	1.171	1.00
56_T	76_V	1.163	1.00
54_I	74_V	1.152	1.00
43_A	72_L	1.140	1.00
126_F	154_I	1.137	1.00
82_H	106_Q	1.123	1.00
51_I	121_L	1.122	1.00
65_A	76_V	1.118	1.00
51_I	72_L	1.117	1.00
23_D	158_F	1.115	1.00
36_Q	73_G	1.100	1.00
40_D	70_L	1.086	1.00
155_E	177_R	1.082	1.00
37_R	40_D	1.081	1.00
50_G	74_V	1.063	1.00
38_I	153_V	1.061	1.00
140_V	147_I	1.059	1.00
82_H	105_S	1.056	1.00
137_V	170_Y	1.036	1.00
36_Q	40_D	1.033	1.00
7_K	11_E	1.029	1.00
8_I	176_A	1.023	1.00
121_L	149_G	1.020	1.00
162_R	172_V	1.020	1.00
46_F	51_I	1.018	1.00
137_V	141_K	1.001	1.00
138_S	141_K	0.998	1.00
45_R	149_G	0.997	1.00
174_S	177_R	0.994	1.00
114_L	140_V	0.978	1.00
85_L	102_Q	0.976	1.00
92_L	142_Q	0.972	1.00
53_K	75_P	0.964	1.00
26_L	78_F	0.951	1.00
141_K	146_S	0.950	1.00
121_L	148_A	0.943	0.99
6_R	10_E	0.935	0.99
55_V	136_L	0.928	0.99
43_A	47_A	0.917	0.99
122_I	133_A	0.914	0.99
41_E	45_R	0.907	0.99
68_T	123_I	0.907	0.99
39_G	68_T	0.907	0.99
3_A	6_R	0.903	0.99
57_I	107_I	0.903	0.99
3_A	34_L	0.902	0.99
147_I	170_Y	0.900	0.99
53_K	114_L	0.899	0.99
117_Q	146_S	0.897	0.99
35_M	67_M	0.890	0.99
97_Y	102_Q	0.868	0.99
64_P	153_V	0.858	0.99
52_T	117_Q	0.848	0.99
28_H	38_I	0.848	0.99
137_V	147_I	0.840	0.99
66_V	76_V	0.838	0.99
55_V	109_V	0.829	0.99
38_I	42_F	0.826	0.99
42_F	45_R	0.816	0.99
63_A	78_F	0.816	0.99
100_T	103_T	0.814	0.99
155_E	161_G	0.804	0.98
39_G	67_M	0.801	0.98
41_E	175_L	0.799	0.98
13_V	112_T	0.797	0.98
138_S	142_Q	0.791	0.98
67_M	70_L	0.789	0.98
122_I	137_V	0.789	0.98
149_G	171_R	0.783	0.98
35_M	39_G	0.769	0.98
37_R	41_E	0.764	0.98
46_F	49_D	0.763	0.98
55_V	122_I	0.761	0.98
82_H	103_T	0.756	0.98
63_A	76_V	0.744	0.97
155_E	174_S	0.743	0.97
122_I	150_I	0.742	0.97
42_F	123_I	0.738	0.97
39_G	70_L	0.731	0.97
157_S	160_P	0.726	0.97
47_A	71_K	0.725	0.97
127_L	152_I	0.722	0.97
120_V	140_V	0.716	0.97
151_G	173_E	0.715	0.97
16_S	19_V	0.707	0.96
91_L	108_A	0.703	0.96
9_E	27_N	0.700	0.96
27_N	30_I	0.699	0.96
41_E	173_E	0.697	0.96
48_K	51_I	0.695	0.96
25_F	29_Q	0.694	0.96
157_S	162_R	0.690	0.96
4_L	176_A	0.688	0.96
92_L	109_V	0.686	0.96
152_I	172_V	0.683	0.96
20_L	158_F	0.671	0.95
96_V	135_G	0.669	0.95
51_I	54_I	0.658	0.95
35_M	63_A	0.656	0.95
82_H	108_A	0.656	0.95
53_K	115_S	0.653	0.94
24_S	27_N	0.650	0.94
111_G	142_Q	0.648	0.94
4_L	37_R	0.647	0.94
55_V	114_L	0.643	0.94
11_E	89_D	0.642	0.94
89_D	111_G	0.641	0.94
11_E	110_S	0.639	0.94
39_G	71_K	0.637	0.94
112_T	143_A	0.635	0.94
52_T	74_V	0.634	0.94
49_D	119_H	0.633	0.93
80_R	85_L	0.630	0.93
63_A	66_V	0.629	0.93
34_L	37_R	0.620	0.93
45_R	151_G	0.616	0.93
90_N	112_T	0.616	0.93
33_L	37_R	0.616	0.93
126_F	156_K	0.613	0.92
149_G	173_E	0.612	0.92
5_K	176_A	0.606	0.92
110_S	113_H	0.601	0.92
51_I	149_G	0.600	0.92
27_N	126_F	0.600	0.92
154_I	178_I	0.596	0.91
16_S	105_S	0.595	0.91
90_N	110_S	0.594	0.91
82_H	93_T	0.591	0.91
35_M	64_P	0.591	0.91
3_A	7_K	0.590	0.91
91_L	110_S	0.590	0.91
131_Q	164_E	0.588	0.91
9_E	112_T	0.588	0.91
167_K	170_Y	0.587	0.91
15_L	86_T	0.586	0.91
32_P	70_L	0.586	0.91
150_I	165_L	0.583	0.90
38_I	64_P	0.583	0.90
42_F	153_V	0.580	0.90
30_I	115_S	0.579	0.90
29_Q	64_P	0.578	0.90
89_D	112_T	0.576	0.90
22_V	154_I	0.576	0.90
53_K	120_V	0.575	0.90
54_I	69_G	0.569	0.89
46_F	173_E	0.568	0.89
31_D	34_L	0.566	0.89
14_V	19_V	0.565	0.89
166_V	171_R	0.564	0.89
46_F	54_I	0.561	0.89
122_I	140_V	0.559	0.88
5_K	178_I	0.555	0.88
3_A	41_E	0.554	0.88
10_E	158_F	0.553	0.88
65_A	69_G	0.552	0.88
54_I	121_L	0.552	0.88
114_L	118_D	0.551	0.88
118_D	145_A	0.551	0.88
141_K	150_I	0.550	0.88
4_L	41_E	0.548	0.87
8_I	23_D	0.544	0.87
80_R	105_S	0.543	0.87
100_T	105_S	0.543	0.87
84_S	101_K	0.542	0.87
152_I	174_S	0.537	0.86
116_D	146_S	0.529	0.86
109_V	143_A	0.527	0.85
8_I	28_H	0.526	0.85
64_P	123_I	0.525	0.85
54_I	72_L	0.524	0.85
118_D	146_S	0.522	0.85
54_I	68_T	0.522	0.85
75_P	78_F	0.521	0.85
83_K	103_T	0.519	0.85
51_I	148_A	0.516	0.84
23_D	156_K	0.516	0.84
127_L	161_G	0.513	0.84
29_Q	63_A	0.511	0.84
18_Q	103_T	0.511	0.84
51_I	119_H	0.510	0.84
3_A	31_D	0.506	0.83
65_A	72_L	0.505	0.83
83_K	108_A	0.504	0.83
131_Q	134_H	0.503	0.83
30_I	89_D	0.502	0.83
120_V	145_A	0.502	0.83
30_I	63_A	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4m0kA	2	0.8866	100	0.35	Contact Map
4lzaA	2	0.8763	100	0.352	Contact Map
1qb7A	2	0.9794	100	0.427	Contact Map
2dy0A	2	0.9072	100	0.46	Contact Map
1y0bA	2	0.9897	100	0.476	Contact Map
1zn8A	2	0.8866	100	0.487	Contact Map
1g2qA	2	0.866	100	0.494	Contact Map
1l1qA	2	0.9021	100	0.501	Contact Map
1o57A	2	0.9278	100	0.511	Contact Map
3qw4B	4	0.8763	99.9	0.553	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0084 seconds.